KEGG   Bradyrhizobium oligotrophicum: S58_56530Help
Entry
S58_56530         CDS       T02484                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
aol00564  Glycerophospholipid metabolism
aol01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aol00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    S58_56530
Enzymes [BR:aol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     S58_56530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_2 FAD_oxidored Pyr_redox FAD_binding_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: BAM91630
UniProt: M4ZYW4
LinkDB All DBs
Position
complement(6418996..6420549)
Genome map
AA seq 517 aa AA seqDB search
MRLLERIYDLAIVGGGVNGCGIARDAAGRGNSVFLCEMNDLASGTSSWSTKLVHGGLRYL
EYYEFRLVREALIEREILWQIAPHIIRPLRFVLPHHSGLRPAWLLRLGLFLYDHLGGRKL
LPPTRSVNLRHDEVGRPLIAGRYSKGFEYSDCFVDDARLVVLTARDAADRGAVIRTRARA
TEIRQDGGVWLVTTENTQTGERETIKARALVNAAGPWVEQVLATGAGVNAKAKVRLVQGS
HIVVRKLYDHDRAYIFQNADGRIIFAIPYQQDFTLIGTTDRDYQGDPAKVKATDEEIAYL
CAALGEYLAKPVKPSDVVWSYSGVRPLYDDGASEAKAATRDYVFELDAPGGLPLLSIYGG
KITTYRRLSEEALERLAPYLKGTKAQEGWTGKSPLPGGDMKVSAVAPLIADLRKTYPFLS
DAHAKRIAYAYGTRAATMLAGATSSADLGQDFGGTLTEREVRYLMTDEWALTAEDIVWRR
SKLGLRMSTAEIAALDAWIVADRERSAMQAREAGGRA
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgttggagcggatctacgacctcgccattgtcggaggcggcgtgaacggctgc
ggcatcgcgcgcgatgcggccggacgcgggaattccgttttcctgtgtgaaatgaacgat
ctggcgagcggaacctcgtcctggtcgaccaagctcgtccatggcggcctgcgctatctc
gaatattacgagtttcgtctggtgcgggaggcgctgatcgagcgcgaaatcctgtggcag
atcgcgccccacatcatccgtccgctacgtttcgtgctgccgcaccattcgggcctgcgt
ccggcctggctgctgcgcctcggcctgttcctctatgaccatctcgggggccgcaagctc
ctgccgccgacccgctcggtcaacctgcggcatgacgaggtcggccgtcccctgatcgcc
ggacgctatagcaaggggttcgaatattccgattgcttcgtcgacgatgcccgtctcgtc
gtgctcaccgcccgcgatgcggccgaccgtggcgccgtgatccgcacgcgcgcccgtgcg
accgagatccggcaggacggcggcgtctggctggtcaccaccgagaacacccagaccggc
gagcgcgagaccatcaaggcgcgtgcgctggtcaatgccgcagggccctgggtggagcag
gtgctggcgaccggtgccggcgtcaatgcaaaagcgaaagtgcggctggtgcagggctcg
cacatcgtggtgcgcaagctgtacgatcacgaccgcgcctacattttccagaacgccgat
ggccgcatcatcttcgcgatcccctatcagcaggacttcacgctgatcggcaccacggac
cgcgactatcagggtgacccggcgaaggtgaaggcgaccgacgaggagatcgcctatctc
tgcgccgcgctcggggagtatctcgccaagccggtcaagccgagcgacgtcgtgtggagc
tattccggggtgcggccgctctatgacgacggcgccagcgaggccaaggctgcgacgcgc
gactatgtgttcgagctcgacgcgcccggcggcctgccgctgctgtcgatctatggcggc
aagatcaccacctatcggcggttgtcggaggaggcgcttgagcgcctcgcgccctatctg
aagggcaccaaggcgcaggagggctggaccggcaagtcgccgttgcccggtggcgatatg
aaggtctcggccgtggcgccgctgatcgccgatctccgcaagacctatccgttcctgtca
gatgcacatgcgaagcggatcgcctacgcctatggcacgcgggctgcgaccatgctcgct
ggtgcgacatcttccgccgatctcggccaggatttcggtggcaccttgacggagcgtgaa
gtcaggtacctgatgacggatgagtgggcgttgacggccgaggacatcgtgtggcggcga
tcgaagctggggttgcgaatgtcgacggccgagattgccgcgctcgacgcgtggatcgtt
gccgaccgggagcgctccgccatgcaggcgcgtgaggcgggaggacgcgcatga

DBGET integrated database retrieval system