KEGG   Bradyrhizobium oligotrophicum: S58_57320Help
Entry
S58_57320         CDS       T02484                                 

Definition
(GenBank) L-idonate 5-dehydrogenase, NAD-binding
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
aol  Bradyrhizobium oligotrophicum
Brite
KEGG Orthology (KO) [BR:aol00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    S58_57320
Enzymes [BR:aol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     S58_57320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Methyltransf_25 Methyltransf_11 ADH_N_assoc NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: BAM91709
UniProt: M4ZD80
LinkDB All DBs
Position
complement(6499693..6500724)
Genome map
AA seq 343 aa AA seqDB search
MRAVVIHAPRDLRIDSFPDPAPGAGEVRVKIEAGGICGSDLHYYHHGGFGTVRIKQPMAL
GHEIAGVIAAVGAGVTGLAEGTRVAVNPSLPCGKCSYCREGLRNQCLDMRFMGSAMRDPH
VQGGFREFVTVDASQAVPIAPSLSPSEAAMAEPLSVCLHAAHQAGSLLGKRVLVTGCGPI
GALSILVARFGGAAEIVVTDVADAPLAVARTLGASHAFNVGAEPSALDPWRAGKGTFDVL
FEASGNQAALRSALDVMRPGGVIVQLGLGGEMTLPVNTLVTKELQLRGTFRFDREFELAL
RLMGEGLLDVKPLISAVLPFEQAVAAFELASDRSRSMKVHLTF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccgtcgtaattcatgcgcccagggatctgcgcatcgacagctttcccgacccg
gcgcccggagcgggcgaggtccgggtcaagatcgaggccggcggcatctgcggctcggat
ctgcactattatcatcacggcggcttcggcaccgtgcgcatcaagcagccgatggcgttg
gggcacgaaatcgctggtgtcatcgccgcggtcggcgccggcgtgaccggtctcgccgag
ggcacgcgcgtcgccgtcaatccgagcctgccatgcggcaaatgcagctattgccgcgag
gggctgcgcaaccagtgcctcgacatgcgcttcatgggcagcgcgatgcgcgatccgcat
gtgcagggcggcttccgcgaattcgtcaccgtcgatgcctctcaggccgtgcccatcgcg
ccgtcgctgtcgccaagtgaagctgcgatggccgagccgctgtcggtctgtctgcatgcc
gcgcaccaggccggctcgctgctcggcaagcgcgtgctggtgaccggctgtggcccgatc
ggcgcgctgtcgatcctggtggcgcgttttggcggcgcggccgagatcgtggtgaccgat
gtcgccgacgcgccgctcgcggtggcgcgcacgctcggtgcaagccatgcgttcaatgtc
ggagcggagccgtcggcgctggatccgtggcgggccgggaagggcacattcgacgtactg
ttcgaggcgtccggcaaccaggccgcattgcggtccgcgctcgacgtcatgaggcccggc
ggcgtcatcgtccagctcgggctcggcggcgaaatgactttgccggtcaatacgctggtc
acgaaggagctgcaattgcgcggcaccttccggttcgaccgcgaattcgagctggcgctg
cggctgatgggcgaggggctgctggacgtcaagccgctgatctcggctgtgctgccgttc
gagcaggcggtcgccgccttcgagctcgccagcgatcgaagccggtcgatgaaggttcat
ttgacgttttga

DBGET integrated database retrieval system