KEGG   Bradyrhizobium oligotrophicum: S58_58780Help
Entry
S58_58780         CDS       T02484                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small chain, RuBisCO small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
aol00630  Glyoxylate and dicarboxylate metabolism
aol00710  Carbon fixation in photosynthetic organisms
aol01100  Metabolic pathways
aol01120  Microbial metabolism in diverse environments
aol01200  Carbon metabolism
Module
aol_M00165  Reductive pentose phosphate cycle (Calvin cycle)
aol_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
aol_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:aol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    S58_58780
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    S58_58780
Enzymes [BR:aol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     S58_58780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: BAM91855
UniProt: M4ZZD8
LinkDB All DBs
Position
complement(6656017..6656436)
Genome map
AA seq 139 aa AA seqDB search
MRVTQGCFSFLPDLTDDQITAQIQYCLEKGWAVNIEFTDDPHPRNTYWEMWGLPMFDLRD
AAGIMRELSECRKIYGDRYIRISAFDSSHGWESIRLSFIVNRPQNEPGFRLDRQETVGRN
QRYSTRSYAAERPEGERYS
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgacccaaggctgcttttccttcctgcccgacctgaccgacgatcagatcacc
gcccagatccagtactgcctggaaaagggatgggctgtgaacatcgagttcaccgacgac
ccgcacccccgcaacacctattgggagatgtggggcctgccgatgttcgacctgcgcgac
gccgccggcatcatgcgcgagctttccgagtgccggaaaatctatggcgatcgctacatc
cgcatctcggcgttcgattcctcccatggctgggagtcgatccggctgtccttcatcgtc
aaccggccgcagaacgagccgggcttccggctcgatcggcaggaaaccgtcgggcgcaat
cagcgttactccacgcgatcctacgccgccgagcgccccgagggcgagcggtactcataa

DBGET integrated database retrieval system