KEGG   Bradyrhizobium oligotrophicum: S58_58960Help
Entry
S58_58960         CDS       T02484                                 

Definition
(GenBank) protochlorophyllide reductase iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
aol00860  Porphyrin and chlorophyll metabolism
aol01100  Metabolic pathways
aol01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aol00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    S58_58960
Enzymes [BR:aol01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     S58_58960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MeaB MipZ AAA_24 SRP54 AAA_26 RE_AccI CBP_BcsQ AAA_25 DUF87
Motif
Other DBs
NCBI-ProteinID: BAM91873
UniProt: M4ZDG8
LinkDB All DBs
Position
complement(6674272..6675177)
Genome map
AA seq 301 aa AA seqDB search
MNVTLRPPLTTAPRRPDGAGSVQVQLDPNVVIGTAKVFSVYGKGGIGKSTTSSNLSVALS
KLGKRVLQIGCDPKHDSTFTLTKRLVPTVIDILEQVNFHAEELRPEDFVYQGYNGVMCVE
AGGPPAGTGCGGYVVGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHADRALIV
AANDFDSIFAMNRIVAAIQAKSRNYPVRLGGVIANRSAATDQIDKFNERAGLKTVAHFPD
LDVIRKSRLKKCTLFEMEASPDVERAQNEYLRLAASLLAGAEPMQAVPLKDRDIFDLLGF
D
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgaccttgagaccgccgttgacgacggcgccgcgccgccccgatggggccggc
agtgtgcaggtgcagctcgatccgaacgtcgtcatcggcaccgcaaaagtgttctcggtg
tacggcaagggcggcatcggcaagagcacgacgtcgtcgaacctctcggtggcgctgtcc
aagctcggcaagcgcgtgctgcagatcggctgcgatcccaagcacgactccaccttcacg
ctcaccaagcggctggtgccgaccgtcatcgacattctcgaacaggtcaatttccacgcc
gaggaactgcggcccgaggatttcgtctaccagggctataacggcgtgatgtgcgtcgag
gccggagggccgccggccggcaccggctgcggcggctatgtcgtcggccagacggtcaaa
ctactgaaggagcatcatctgctcgaagacaccgatgtggtgatcttcgacgtgctcggc
gacgtcgtctgcggcggcttcgcagcgcccttgcagcacgccgaccgcgcgctgatcgtg
gctgcgaacgatttcgactcgatcttcgcgatgaaccgcatcgttgccgcgatccaggcc
aagtcgcgcaactatccggtgcggctcggcggcgtgatcgccaaccgcagcgccgcgacc
gaccagatcgacaagttcaacgagcgggccggcctgaagacggtggcgcacttccccgat
ctcgacgtcatcaggaagagccgcctgaagaagtgcacgctgttcgagatggaggcttcg
cccgacgtcgagcgcgcgcagaatgagtacttgcgcctcgcagcctcgctgctcgcaggt
gccgagccgatgcaggcggtgccgctgaaggaccgcgacatcttcgatcttcttggcttt
gattga

DBGET integrated database retrieval system