KEGG   Bradyrhizobium oligotrophicum: S58_71410Help
Entry
S58_71410         CDS       T02484                                 

Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
aol00500  Starch and sucrose metabolism
aol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    S58_71410
Enzymes [BR:aol01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     S58_71410
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     S58_71410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: BAM93106
UniProt: M4ZHK3
LinkDB All DBs
Position
8099144..8100871
Genome map
AA seq 575 aa AA seqDB search
MIDDLWYKNAVFYCLSVGTYMDADGDGIGDFKGLTRRLDYLHGLGITAIWLMPFQPSPQR
DDGYDVADYYGVDPRYGTLGDFVQFTHGCKQRGIRVIIDLVVNHTSDQHPWFVEARSAKT
SRTRDWYVWSDKKPANANTGMVFPGVQKSTWTRDKESGAWYFHRFYDFQPDLNTSNPEVQ
AELLKIMGFWIQLGVSGFRMDAVPFVIATKGADVKKPVEQYDMLRTFREFLQWRQGEAII
LAEANVRPETDMEYFGADGDRMHMMFNFHVNQHLFYALAAADTRPLAKALVETKPRPASA
QWGLFLRNHDELDLGRLTKQQREAVFKAFGPDKSMQLYDRGIRRRLAPMLGGDRRRIELA
YSLMFTLPGTPVIRYGDELAMGDDLSLPERNCARTPMQWSTEPQGGFTKCETAVSPVIDH
GPYGYEHVNAAKQRRDPNAMLNWTERIIRMRKEVPEVGWGDFEVISTKDPAVLIMRYDWR
NNSVLFVHNLDEKPREISFDAGLPDDGGKLLINLLSEDHSHADDRGRHTLVLEPYDYRWY
RVGGLDYLLRRSDIETKSPAKRARKAKRVRRSRGR
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgatctctggtacaagaatgccgtgttttactgcctgtcggtcggcacctac
atggatgccgatggtgatggcatcggcgacttcaagggactgacacgtcgcctggattat
ctgcacgggctcggcatcaccgcaatctggctgatgccgttccagccctcgccgcagcgc
gacgacggctacgacgtcgccgactactatggcgtcgatccgcgctacggcacgctcggc
gatttcgtgcagttcacgcatggctgcaagcagcgcggcatccgcgtcatcatcgatctc
gtcgtcaaccacacctccgaccagcatccatggttcgtcgaggcacgcagcgcgaagacc
tcgcgcactcgcgactggtatgtgtggtcggacaagaagccggcaaacgccaacaccggc
atggtgtttcccggggtgcagaagtcgacatggacgcgcgacaaggagtccggcgcctgg
tactttcaccgcttctacgatttccagcccgatctcaacacctccaatcccgaggtgcag
gccgagctcctcaagatcatgggcttctggatccagctcggcgtatccggcttccgcatg
gacgccgtgccgttcgtgatcgcgaccaagggcgctgatgtcaagaagcccgtcgagcag
tacgacatgcttcggaccttccgcgaattcctgcaatggcgccagggcgaggcgatcatc
ctggccgaggccaacgtgcggcccgagaccgacatggagtatttcggcgccgacggcgac
cgcatgcacatgatgttcaacttccacgtcaaccagcacctgttctacgcgctcgccgcc
gccgacacccggccgctcgccaaggcgttggtcgagaccaaaccacgcccggcctccgcg
caatggggcctgtttctgcgcaatcacgacgagctcgatctgggccggctgacgaagcag
cagcgtgaggccgtgttcaaggcgttcgggcccgacaagagcatgcagctctacgatcgc
ggcatccggcggcggctggcgccgatgctgggcggcgaccggcgccgcatcgagctcgcc
tacagcctgatgttcacgctgcccggcacgcccgtgatccgctatggcgacgagctcgcg
atgggcgacgatctctccctgcccgaacgcaactgcgcgcgcacgccgatgcaatggtcg
accgaaccgcagggcggcttcaccaagtgcgagacagccgtctcgccggtgatcgaccat
ggtccctatggctacgagcacgtcaacgccgccaagcagcggcgtgatccgaacgcgatg
ctgaactggaccgagcgcatcatccgcatgcgcaaggaggtgccggaagtcggctggggc
gatttcgaggtgatctccaccaaggatcccgccgtcctgatcatgcgctacgactggcgc
aacaactcggtgctgttcgtgcacaatctcgacgagaagccgcgcgagatatcgttcgac
gctggcctgcccgacgacggcggcaagctgctgatcaacctgctgtccgaggatcacagc
cacgccgacgaccgcggccgtcacaccctggtgctcgagccctacgactaccgctggtac
cgcgtcggcgggctggactatctgctcaggcggagcgacatcgagacgaagagcccggcg
aagcgggcgcggaaggcgaagcgggtacggaggtcacgcgggcggtag

DBGET integrated database retrieval system