KEGG   Aquabacterium olei: DEH84_00470Help
Entry
DEH84_00470       CDS       T05429                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aon  Aquabacterium olei
Brite
KEGG Orthology (KO) [BR:aon00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DEH84_00470
Enzymes [BR:aon01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DEH84_00470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA Glutaredoxin FAD_binding_2 FAD_oxidored HI0933_like FAD_binding_3 K_oxygenase DAO Thi4 AlaDh_PNT_C FMO-like
Motif
Other DBs
NCBI-ProteinID: AWI55008
UniProt: A0A2U8FW35
LinkDB All DBs
Position
115614..117173
Genome map
AA seq 519 aa AA seqDB search
MLDDSLKAQLGAYLERVQQPFEIVASLSDSENSREMLELLQTIQGLRADKITLKTDGQDA
RKPSFTLQRAGSDTSLRFAGLPLGHEFTSLVLALLWTGGHPPKEEAETLDNIRALDGDFN
FEVYMSLSCHNCPDVVQALSLMAILNPKVKTTVIEGGAFQEEVEKREIMAVPMVFLNGQV
FASGKMSVAEIVAKLDTNSSAKEAAKIDAKAPYDVLIVGGGPAGAAAGVYAARKGIRTGI
AAERFGGQVNDTLAIENYISVLETDGPKLAAALEAHAKAYDVDIMNLQKAAQIIPAAKPG
DLIQVKMENGGTLKAKTVILSTGARWRNVNVPGEAEYKNKGVAYCPHCDGPLFKGKRTAV
IGGGNSGVEAAIDLAGIVAHVTLIEFADTLKADAVLVNKLKSLPNVTIHTNAQTTEITGA
EGKVNGLKYKDRATGEEHTVPLEGVFVQIGLVPNTEFLRGTVELSKFGEIIVDAKGHTNV
PGVFAAGDCTTVPYKQIVIAAGAGATAALSAFDHLIRQG
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgacagcctcaaagcccaactcggcgcctacctggagcgcgtgcaacagccc
ttcgagatcgtggcctccctgagcgacagtgaaaactcgcgcgagatgctcgagctgctg
cagacgatccaaggtctgcgcgccgacaagatcaccctgaagaccgacgggcaggacgcc
cgcaagccttcgttcacgctgcagcgtgccggcagcgacaccagcctgcgctttgccggc
ctgccgctgggccacgagttcacctcgctggtgctggcgctgctgtggacgggcggtcac
cccccgaaggaagaagccgagacgctggacaacatccgcgccctggacggcgacttcaac
ttcgaggtctacatgtccctgagctgccacaactgcccggacgtggtgcaggcgctgtcg
ctcatggccatcctgaacccgaaggtcaagaccacggtcatcgaaggcggcgccttccag
gaagaggtcgagaagcgcgagatcatggcggtgcccatggtgttcctcaacggccaggtg
tttgcctcgggcaagatgtcggtggccgagatcgtggccaagctcgacaccaactcgtct
gccaaggaagccgccaagatcgacgccaaggcgccgtacgacgtgctgatcgtgggcggt
ggccctgccggtgcagccgcgggtgtgtacgcagcccgcaagggcatccgcaccggcatc
gccgccgaacggtttggcgggcaggtgaacgacacgctggccatcgagaactacatctcg
gtgctggaaaccgacgggccgaagctggctgccgcgctggaagcccacgccaaggcgtac
gacgtcgacatcatgaacctgcagaaggccgcgcagatcatcccggctgcgaagcccggt
gacctgattcaggtgaagatggaaaacggcggcacgctcaaggccaagaccgtgatcctg
tcgaccggtgcccgttggcgcaacgtgaacgtgcccggcgaagccgagtacaagaacaag
ggcgtggcctactgcccgcactgcgatggcccgctgttcaagggcaagcgcacggccgtc
atcggcggcggcaactcgggtgtcgaggccgccatcgacctggcgggcatcgtggcccac
gtgacgctgatcgagtttgccgacacgctcaaggccgacgccgtgctggtcaacaagctc
aagagcctgccgaacgtgaccatccacaccaacgcgcagaccaccgagatcaccggcgca
gagggcaaggtcaatggcctgaagtacaaggaccgcgcgaccggtgaagagcacacggtg
ccgctggaaggcgtgttcgtgcagatcggcctggtgcccaacaccgagttcctgcgcggc
acggtcgagttgagcaagttcggcgagatcatcgtcgacgccaagggccacaccaacgtg
ccgggcgtgttcgcggccggcgactgcaccacggtgccgtacaagcagatcgtgatcgcg
gccggggccggtgcgacggcggcattgagcgccttcgaccacctgatccgccagggttga

DBGET integrated database retrieval system