KEGG   Aquabacterium olei: DEH84_02255Help
Entry
DEH84_02255       CDS       T05429                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aon  Aquabacterium olei
Pathway
aon00620  Pyruvate metabolism
aon00680  Methane metabolism
aon01100  Metabolic pathways
aon01120  Microbial metabolism in diverse environments
aon01200  Carbon metabolism
Module
aon_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DEH84_02255
  09102 Energy metabolism
   00680 Methane metabolism
    DEH84_02255
Enzymes [BR:aon01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DEH84_02255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AWI52379
UniProt: A0A2U8FN20
LinkDB All DBs
Position
505472..508285
Genome map
AA seq 937 aa AA seqDB search
MHPTDHESAPSQDPHHPLREDIRLLGRVLGDTVREQHGEATYELVDQIRRHSVRFRRADD
QAARQALEATLDSLSREQMLQVIRSFSYFSLLANIAEDQHQIRTQRQAALTGHAATEGTL
EHALGRFAAKGLDAQQVLDLIGHAQIAPVLTAHPTEVRRHSILHEQMQLARLLRERDLTP
QTPEERAESEEELRRIVLTLWQTRLLRPTKLSVLDEVANSLETHERTFLREVPRLYSHLE
DRLRADLKQARAPQADELELPNFLHVASWIGGDRDGNPFVTAQVLDSALRMQAECVLRHY
LAELNNLGLELSISALLANPSEALLNLAARSPDQSQHRQDEPYRRAISGLYARLAATYQQ
LVGRKPARPALGEAPAYETAAELLADLNVIHRSLKANGSVSLTRGRLRQLRRAVQVFGFS
LAPLDLRQNADVHEQVIADLLEAAEPGSQYLALPEEQRVARLLDELQTARPLYSPHIDYS
ELSRGEIAIFQQAQLAHQRYGSQSIAQCIISKTASVSDLLEVAVLLKECGLLKPARGADA
PTLAVNIVPLFETIGDLRAAPAIMDALLSQPLYRALLQSRGDVQEVMLGYSDSNKDGGFL
TSGWELYKAEIGLVEVFARHGVRLRLFHGRGGSVGRGGGPSYQAILAQPPGAVQGQVRLT
EQGEVIAAKYGQPETGRRNLEVLVAATLTASLLPPNKDVPPEYLDVMEELSATAFAAYRH
LVYETPGFEQFFWESTVIAEIAHLNIGSRPASRKKSTSIDDLRAIPWVFSWAQCRIMLPG
WYGFGSAVEAYVQKHGEAGQQRLQAMHANWPYLSSLLSNMDMVLAKSDLAIASRYAGLVS
DKALSEAIFGRIQAEHDRTVRHLLAVTGQTALLERHPELQRHIADRHPYLDPLNHLQVTL
LQSFRERQQRNEEPDERVQRGIHLTINGLAQGLRNSG
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgaccgaccacgaatccgccccttcccaagaccctcaccaccccctgagggaa
gacatccgcctgctgggccgcgtcctgggtgacaccgtgcgcgagcagcacggcgaagcc
acctacgagctcgtcgaccagatccgccgccactcggtgcgctttcgccgcgccgacgac
caggccgcgcgccaggcgctcgaagccacgctcgacagcctctcgcgcgagcagatgctg
caggtcatccgctcgttcagctacttttcgttgctggccaacatcgcggaagaccagcac
cagatccgcacccagcggcaggcggccctgactggccacgccgccaccgagggcacgctc
gaacacgcgctgggccgctttgccgccaaggggctcgacgcccagcaggtgctcgacctc
atcggccacgcgcagattgcgccagtgctgacggcccaccccaccgaagtccgccgccac
agcatcctgcacgagcagatgcagctcgcgcgcctgctgcgcgagcgcgacctcacccca
cagacgcccgaagagcgcgccgaatccgaagaagaactgcgccgcatcgtgctgacgctg
tggcagacccgcctgctgcgcccgaccaagctgtcggtgctggacgaagtcgccaacagc
ctggaaacccacgagcgcaccttcttgcgcgaagtgccgcgcctgtacagccacctcgaa
gaccgcctgcgcgccgacctcaagcaggcccgcgcgccgcaggccgacgagctcgaactg
cccaacttcctgcatgtggccagctggattggcggtgaccgcgacggcaaccccttcgtc
accgcgcaggtgctcgactcggccctgcgcatgcaggccgagtgcgtgctgcgccactac
ctggccgagctcaacaacctcgggctcgagctgtcgatctcggcgctgctggccaacccg
tccgaggcgctgctgaacctggccgcccgctcgcccgaccagtcccagcaccgtcaggac
gagccgtaccgccgcgccatcagcggcctgtacgcccgcctggccgccacctaccagcag
ctggtcggccgcaagccggcgcgtccggccctgggcgaagcgccggcctacgagaccgcc
gccgaactgctcgccgacctcaacgtcatccaccgctcgctcaaggccaacggctccgtg
tcgctgacccgcgggcgcctgcgccagctgcgccgcgccgtgcaggtcttcggcttcagc
ctcgccccgctcgacctgcgccagaacgccgacgtgcacgagcaggtcattgccgacctg
ctcgaagccgccgagccgggctcgcagtaccttgcgctgccggaagagcagcgcgtggcg
cgcctgctcgacgagctgcagaccgcccgcccgctgtactcgccccacatcgactacagc
gagctgagccggggcgaaatcgccatcttccagcaggcccagctggcgcaccagcgctac
ggcagccagtcgatcgcgcagtgcatcatcagcaagaccgccagcgtgtccgacctgctg
gaagtggccgtgctgctcaaggagtgcggcctgctcaagcccgcccgcggcgccgatgcg
cccacgctcgccgtcaacatcgtcccgctgttcgagaccatcggcgacctgcgcgccgcc
ccggccatcatggacgcgctgctgtcgcagcccctgtaccgcgcgctgctccagagccgt
ggcgacgtgcaggaagtcatgctcggctactccgattcgaacaaggacggcggtttcctc
acctccggctgggagctctacaaggccgagatcggcctggtcgaggtctttgcgcgccac
ggtgtgcgcctgcgcctcttccatggccgcgggggctccgtcggccgcggcggcggcccc
agctaccaggccatcctcgcgcagccgccgggcgccgtgcagggccaggtccgcctgacc
gaacagggcgaggtgattgccgccaagtacggccagcccgaaaccggccgccgcaacctc
gaagtgctcgtggccgccacgctgactgccagcctgctgccgcccaacaaggacgtcccg
cccgagtacctcgacgtgatggaggaactctcggccaccgcgttcgcggcctaccgccac
ctcgtctacgagaccccgggcttcgagcagttcttctgggaatcgaccgtcatcgccgag
atcgcccacctcaacatcggcagccgcccggcttcgcgcaagaagtcgacctcgatcgac
gacctccgcgccatcccctgggtgttcagctgggcccagtgccgcatcatgctgcccggc
tggtacggcttcggcagcgcggtcgaggcctatgtgcagaagcacggtgaagccggccag
cagcgcctgcaggccatgcacgccaactggccctacctgtcgagcctgctgtccaacatg
gacatggtgctggccaagtccgacctggccattgcctcacgctacgccgggctggtcagc
gacaaggccttgagcgaagccatcttcggccgcatccaggccgagcacgaccgcacggtg
cgtcacctgctggcggtcaccgggcagaccgcgctgctggagcgccacccggaactgcag
cgccacattgccgaccgccacccctacctcgatccgctgaaccacctgcaggtgacgctg
ctgcagagcttccgcgagcgccagcagcgcaacgaggagccggacgagcgcgtgcagcgc
ggcatccacctcaccatcaacggcctggcccaggggctgcgcaacagcggctga

DBGET integrated database retrieval system