KEGG   Aquabacterium olei: DEH84_05290Help
Entry
DEH84_05290       CDS       T05429                                 

Definition
(GenBank) hypothetical protein
Organism
aon  Aquabacterium olei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecR Y_Y_Y LysM
Motif
Other DBs
NCBI-ProteinID: AWI52901
UniProt: A0A2U8FPB8
LinkDB All DBs
Position
complement(1187198..1188862)
Genome map
AA seq 554 aa AA seqDB search
MAYFHPLPGRVLTLAAMLLALAPCGHAASPAPTADTLIYETREGDTLIALGERLLARPQD
WRRVAELNRIEAPRRIPVGTRLRFPVSLLKHVPRDGTVLAAVGDASLQAPDGAPRSIRPG
DALPPGSVVRTASNGYVTVKLADGSVLRIQADTEARLDTSRQYQQAGFFASVWEVVRGRV
EALVTHMTGGEPRFQVRTPQAVLGVRGTEFRVDADATRGQTRGETLTGAVAVQGGRGETL
VRAGFGTVTQAGMAPAAARPLPLAPDMAGLPALQERILVRFQLPSVPQAVAYRGQVAEDE
QFQIVRGEVTSSTPQLRFADLPDGDYVLRARAIDAQGLESPDAIHRFRLKARPEAPIAAT
PAPGSKWRTASVPLAWAAHPKAWRYRVQVANAADFQSPLLDRDDLTETSLDVPLPPGDYH
WRVATTAAGSDRGPWSDPQRFSVRPQPAALPPPQVTDDTLAFQMQGEPGQVFELQLGRDT
DFQSLAATQRSGDARIVLPKPQEGGLLHVRYRAIDPDGFIGPWTAPQQLVLPACVRSGTG
ECLGASGRFAVSPP
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatttccaccccctccccggccgggtcctgacgctggcggcgatgcttctggcg
ctggccccgtgcggccacgccgcttcacccgccccgactgccgacacgctgatctatgag
acgcgcgaaggcgacacgctcatcgcgctcggcgagcgcctgctggccagaccgcaggat
tggcgccgggtggccgagctcaaccggatcgaggccccgcgccgcattccggtcggcaca
cgcctgcgtttccccgtcagcttgctgaagcacgtgccgcgcgacggcaccgtcctggcg
gctgtgggcgacgcgagcctgcaggctccggacggcgcaccgcgcagcatccgcccgggc
gatgccttgccaccgggcagcgtggtgcgcacagcgagcaatggttatgtcacggtgaag
ctggccgacggctcggtgttgcgcatccaggccgacaccgaggcgcggctcgacacctcg
cgtcagtaccagcaggctggtttcttcgcctcggtgtgggaggtcgttcgcggccgtgtc
gaggcgctggtgacccacatgacagggggcgaaccgcgcttccaggtcaggacaccgcag
gccgtgctgggcgtgcgcggcacggagttccgcgtggacgccgatgcgacccgcggccag
acacgtggcgagaccctcaccggggccgttgccgtacagggtggtcggggcgaaaccctg
gtgcgcgccgggttcggcaccgtgacgcaggcgggcatggcgccggccgcagcgcgccct
ctgccgctggcgccggacatggcaggcctgcccgcgcttcaggaacgcatccttgtgcgc
ttccagttgccctcggtgccccaggcggtggcctaccgggggcaggtggccgaagacgag
cagttccagatcgtccggggcgaggtgacgagcagcacccctcaactgcgtttcgccgat
ctgcctgacggcgactacgtgctgcgcgcgcgcgccatcgacgcgcaaggcctggaaagc
cctgacgccatccatcgcttcaggttgaaggctcgccccgaggcgccgatcgcggccacg
ccggcgcctggttcgaagtggcggacggcctcggtgccgctggcatgggccgcccacccg
aaagcctggcgctatcgcgtgcaggtggccaacgcagccgacttccagtcgccgctgctc
gaccgcgatgacctgaccgagacctcgctggatgtgcccctgccgccgggtgactatcac
tggcgcgtcgcgaccacggcggcgggctccgatcgcgggccctggagtgatccgcaacgg
ttctcggtgcggccccagcccgccgccttgccgcccccccaggtcaccgacgacaccctg
gcctttcaaatgcagggcgaaccgggacaggtgttcgagttgcaactcgggcgcgacacg
gacttccagtcgctggcagccacgcagcgcagtggcgatgcccgcatcgtgctgcccaaa
ccccaggaaggtgggctgcttcacgtgcgctatcgcgccatcgacccggacggcttcatc
ggaccgtggacggccccccagcagctggtcctgcccgcctgtgtgcgcagcggaacgggc
gagtgccttggcgccagcggtcgtttcgccgtgtcgccgccctga

DBGET integrated database retrieval system