KEGG   Aquabacterium olei: DEH84_06680Help
Entry
DEH84_06680       CDS       T05429                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
aon  Aquabacterium olei
Pathway
aon00061  Fatty acid biosynthesis
aon00780  Biotin metabolism
aon01100  Metabolic pathways
aon01130  Biosynthesis of antibiotics
aon01212  Fatty acid metabolism
Module
aon_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:aon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DEH84_06680
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DEH84_06680
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    DEH84_06680
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aon01004]
    DEH84_06680
Enzymes [BR:aon01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     DEH84_06680
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     DEH84_06680
Lipid biosynthesis proteins [BR:aon01004]
 Fatty acid synthase
  Component type
   DEH84_06680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AWI53150
UniProt: A0A2U8FQ93
LinkDB All DBs
Position
complement(1492831..1493616)
Genome map
AA seq 261 aa AA seqDB search
MGFLAGKRLLITGLLSNRSIAYGIAKACKREGAELAFSYVGERFKDRITEFAREFDSELV
FDCDVANDEQIAALFADLAKTWPTFDGFVHSIGFAPREAIAGDFLEGLSREAFRIAHDIS
AYSFPAMAKAALPYLNPNAALLTLSYLGAERIVPAYNTMGLAKASLEASVRYTASSLGPK
GIRVNGISAGPIKTLAASGIKGFGKILDVVEQNAPLRRNVTIEDVGNVAAFMLSDLAAGV
TAEITYVDAGFSQVMGGVTEA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggctttctcgccggcaagcgcctgctgatcaccggactgctgtccaatcgttccatc
gcctatggcattgccaaggcctgcaagcgcgaaggcgccgagctcgcattcagctacgtg
ggcgagcgcttcaaggaccgcatcaccgaattcgccagggaattcgactcggagctggtg
ttcgactgcgacgtggcgaatgacgagcagatcgccgcgctgttcgcggacctggcgaag
acctggccgacgttcgacggcttcgtgcactcgatcggctttgcaccgcgtgaagcgatt
gccggcgacttcctggaaggtctgtcgcgcgaggccttccgcatcgcgcacgacatctcg
gcctacagcttcccggccatggccaaggcggccctgccctacctgaacccgaacgccgcg
ctgctgacgctgtcctacctgggcgccgagcgcatcgtgccggcatacaacaccatgggc
ctggccaaggcgtcgctcgaggccagcgtgcgctacaccgcgtccagcctgggcccgaag
ggcatccgcgtcaatggcatctcggccggcccgatcaagaccctggctgcctcgggcatc
aagggctttggcaagatcctcgacgtggtggagcagaacgccccgctgcgccgcaatgtg
acgatcgaagacgtcggcaacgtggctgcgttcatgctgtcggatctggccgcgggcgtg
accgccgagatcacctatgtggatgctggcttcagccaggtcatgggtggtgtgacggag
gcctga

DBGET integrated database retrieval system