KEGG   Aquabacterium olei: DEH84_11950Help
Entry
DEH84_11950       CDS       T05429                                 

Gene name
rbcL
Definition
(GenBank) ribulose-bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
aon  Aquabacterium olei
Pathway
aon00630  Glyoxylate and dicarboxylate metabolism
aon01100  Metabolic pathways
aon01120  Microbial metabolism in diverse environments
aon01200  Carbon metabolism
Module
aon_M00165  Reductive pentose phosphate cycle (Calvin cycle)
aon_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:aon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DEH84_11950 (rbcL)
Enzymes [BR:aon01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     DEH84_11950 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AWI54059
LinkDB All DBs
Position
complement(2669743..2671209)
Genome map
AA seq 488 aa AA seqDB search
MNKPVEEGIIRDARQRYSAGVLKYRQMGYWEPDYVPKDTDVVCLFRITPQEGVDPVEAAA
AVAGESSTATWTVVWTDRLTACDTYRAKAFKVEPVPGQPGQVFAWVAYDLILFEEGSIAN
MTASLIGNVFSFKPLKACRLEDIRIPVAYVKTFKGPPTGLIVERERLDKFGRPLLGATTK
PKLGLSGRNYGRVIYEGLKGGLDFMKDDENINSQPFMHWRDRFLYVMDAVNKASAATGEV
KGSYLNVTGATMEDIYERAEFAKELGSVVIMVDLVVGWSAIQSVANWARKHDMIVHMHRA
GHGTYTRQKSHGVSFRVIAKWLRLAGVDHLHAGTAVGKLEGDPLMVQGYYNVCREAYNRQ
DLPRGLFFDQDWADLKKVMPVASGGIHAGQMHQLLSLFGDDVILQFGGGTIGHPAGIQAG
AVANRVALEAMVKARNEGRDIDEEGPEILQQAARWCAPLAQALDTWRDVAFNYASTDTSD
HVATPALA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagccagtcgaagagggcatcatccgcgacgcccggcagcgctacagcgccggg
gtgctgaagtaccgccagatgggctactgggagcccgactacgttccgaaggacacggac
gtggtgtgcctcttccgcatcacgccgcaagagggcgtcgacccggtcgaggccgcggcc
gcggtggccggcgaaagcagcaccgccacctggacggtggtctggacggaccgcctcacg
gcctgcgacacctaccgggccaaggccttcaaggtggagcccgtgcccggccagccggga
caggtgttcgcgtgggtggcctacgacctcatcctcttcgaggaaggctcgatcgccaac
atgacggccagcctgatcggcaacgtcttcagcttcaagccgctgaaggcctgccggctg
gaggacatccgcatcccggtggcctatgtcaagaccttcaaggggccgcccaccggcttg
atcgtggagcgcgagcggctcgacaagttcggccggcccctgctgggcgccaccaccaag
cccaagctcggcctgtccggccgcaactatggccgcgtgatctacgaggggctcaagggc
gggctcgatttcatgaaggacgacgagaacatcaactcgcagcccttcatgcactggcgc
gatcgctttctgtacgtgatggacgcggtcaacaaggccagcgccgccaccggcgaggtc
aagggcagttacctgaacgtgaccggcgcgacgatggaagacatctacgagcgcgccgag
ttcgcgaaggagctgggctcggttgtcatcatggtcgacctggtcgtgggctggagcgcc
atccagagcgtggccaactgggcgcgcaagcacgacatgatcgtgcacatgcaccgcgcc
ggccacggcacctacacgcggcagaaatcccacggcgtgagcttccgcgtgatcgccaag
tggctgcgcctggcgggcgtcgaccacctgcatgcgggcaccgccgtgggcaagctcgag
ggcgatccgctgatggtgcagggctattacaacgtctgccgtgaagcctacaaccggcag
gatctgccgcgcgggctgttcttcgaccaggactgggccgacctcaagaaggtgatgccg
gtggcctcgggcggcatccacgccgggcagatgcaccagctgctgagcctgttcggtgac
gacgtgatcctgcagttcggtggcggcaccatcggccaccccgccggcatccaggccggc
gctgtggccaaccgcgtggcgctcgaagccatggtgaaggcacgcaacgagggacgtgac
atcgacgaggaaggccccgagatcctgcagcaggccgcccgttggtgcgcgccgttggcc
caggcgctcgacacctggagggacgtggccttcaactatgcctcgaccgacaccagcgac
cacgtcgccacccccgcccttgcctga

DBGET integrated database retrieval system