KEGG   Aquabacterium olei: DEH84_12255Help
Entry
DEH84_12255       CDS       T05429                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
aon  Aquabacterium olei
Pathway
aon00020  Citrate cycle (TCA cycle)
aon00190  Oxidative phosphorylation
aon00650  Butanoate metabolism
aon01100  Metabolic pathways
aon01110  Biosynthesis of secondary metabolites
aon01120  Microbial metabolism in diverse environments
aon01130  Biosynthesis of antibiotics
aon01200  Carbon metabolism
Module
aon_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aon_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aon_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DEH84_12255 (sdhB)
   00650 Butanoate metabolism
    DEH84_12255 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DEH84_12255 (sdhB)
Enzymes [BR:aon01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DEH84_12255 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     DEH84_12255 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4_4 Fer4 Fer2
Motif
Other DBs
NCBI-ProteinID: AWI54102
UniProt: A0A2U8FSQ8
LinkDB All DBs
Position
complement(2731220..2731927)
Genome map
AA seq 235 aa AA seqDB search
MSQKRTFQIYRYDPDKDAKPYMQTIEIELDGHERMLLDALVKLKAVDPTLSFRRSCREGV
CGSDAMNINGKNGLACLTNMRTLPGTIVLKPLPGLPVVRDLIVDMTQFFKQYNSIKPYLV
NDTPPPDKERLQSPEEREELDGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIA
DSRDQATAERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVKRAV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaaagcgcactttccagatctatcgctacgatcctgacaaggacgccaagccc
tacatgcagaccatcgagatcgaactcgacggtcacgagcgcatgctgctggacgccctg
gtcaagctcaaggctgtggaccccaccctgtcgttccgccgttcgtgccgtgaaggcgtg
tgcggttcggacgccatgaacatcaacggcaagaacggtctggcctgcctgaccaacatg
cgcacgctgcccggcacgatcgtgctgaagccgctgcccggcctgcccgttgtccgcgac
ctgatcgtggacatgacgcagttcttcaagcagtacaactcgatcaagccgtacctggtc
aacgacacgccgccgcccgacaaggagcgtctgcagtcgcccgaagagcgcgaagagctc
gacggtctgtacgagtgcatcctgtgcgccagctgctccaccagctgccccagcttctgg
tggaatcccgacaagttcgtgggccccgccggtctgctgcaggcctaccgcttcatcgcc
gacagccgcgatcaggccacggccgagcgcctggataacctggaagacccataccgtctg
ttccgttgccacaccatcatgaactgcgtggacgtctgccccaagggcctgaaccccacg
aaggccattggcaagatcaaggaattgatggtcaagcgcgccgtctga

DBGET integrated database retrieval system