KEGG   Aquabacterium olei: DEH84_12260Help
Entry
DEH84_12260       CDS       T05429                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
aon  Aquabacterium olei
Pathway
aon00020  Citrate cycle (TCA cycle)
aon00190  Oxidative phosphorylation
aon00650  Butanoate metabolism
aon01100  Metabolic pathways
aon01110  Biosynthesis of secondary metabolites
aon01120  Microbial metabolism in diverse environments
aon01130  Biosynthesis of antibiotics
aon01200  Carbon metabolism
Module
aon_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aon_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aon_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DEH84_12260
   00650 Butanoate metabolism
    DEH84_12260
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DEH84_12260
Enzymes [BR:aon01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DEH84_12260
    1.3.5.4  fumarate reductase (quinol)
     DEH84_12260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO FAD_binding_3 Thi4 HI0933_like GIDA
Motif
Other DBs
NCBI-ProteinID: AWI54103
UniProt: A0A2U8FSS0
LinkDB All DBs
Position
complement(2731957..2733735)
Genome map
AA seq 592 aa AA seqDB search
MTAIATSLPTRKFDVVIVGAGGSGMRASLQLSLAGLNVAVLSKVFPTRSHTVAAQGGIGA
SLGNMSEDNWHYHFFDTVKGSDWLGDQDAIEFMCREAPKVVYELEHFGMPFDRNPDGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVKARTQFFVEWMALDLIRDADG
DVVGVTALEMETGDVHILHAKTVLFATGGAGRIYQASTNAFINTGDGLGMAARAGIPLED
MEFWQFHPTGVAGAGVLLTEGCRGEGAILRNANGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGCGPNKDYVLLDMTHLGAETIMKRLPSVYEIGHNFANVDITKEPIPVVPTIHYQ
MGGIPTNVHGQVVVPANGKPNEIINGLYAVGECSCVSVHGANRLGTNSLLDLVVFGRAAG
NHIVDFNLKTKNHKPLPKDAADYTLSRLARLDNQKGGEYCQDVANDIRSTMQKHAGVFRT
QASMEEGVKKIADVRERVKSIGLKDNSKVFNTARIEALEVENLIEAAQATMVSAAARPES
RGAHAHNDFPNRDDDNWMKHSLWYSEGNRLDYKPVNLKPLTVESVPPKVRTF
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctatcgctacctctcttcccacccgcaagtttgacgtcgtcatcgtgggtgcc
ggcggctccggcatgcgtgcctcgctgcagctctccctggccggcctgaacgtcgctgtc
ctgtccaaggtcttcccgacccgctcgcacaccgtcgcggcgcagggcggcatcggtgcc
tcgctgggcaacatgtcggaagacaactggcactatcacttcttcgacaccgtcaagggc
tccgactggctcggcgaccaggacgccatcgagttcatgtgccgcgaagcaccgaaggtc
gtgtacgagctcgagcacttcggcatgccgttcgaccgcaaccccgacggcaccatctac
cagcgtccgttcggcggccacaccgccaattacggtgaaaagcccgtgcagcgcgcctgc
gccgcggccgaccgtaccggccacgccctgctgcacaccctgtaccagcagaacgtcaag
gcccgcacccagttcttcgtggagtggatggccctcgacctgatccgcgacgccgacggc
gacgtggtgggtgtgaccgccctcgaaatggaaaccggcgacgtgcacatcctgcacgcc
aagaccgtgctgttcgccaccggtggcgccggccgcatctaccaggcttccaccaacgcc
ttcatcaacaccggcgacggcctgggcatggcggctcgcgccggcatcccgctggaagac
atggagttctggcagttccaccccaccggcgtggccggcgcgggcgtgctgctgaccgaa
ggctgccgcggcgaaggcgccatcctgcgcaacgccaacggcgagcgcttcatggaacgc
tacgccccgaccctgaaggacctggctccgcgtgacttcgtgtcccgctcgatggaccag
gaaatcaaggaaggccgtggctgcggtcccaacaaggactacgtgctgctggacatgacc
cacctgggtgccgagacgatcatgaagcgtctgccctcggtgtacgagatcggccacaac
ttcgccaacgtcgacatcaccaaggagccgatccccgtggtgccgaccatccactaccag
atgggtggcattccgacgaacgtgcacggccaggtcgtcgtgcccgccaacggcaagccc
aacgagatcatcaacggcctgtacgccgtgggtgagtgctcctgcgtgtcggtgcacggc
gccaaccgcctgggcaccaactcgctgctcgacctcgtggtgttcggccgtgccgccggc
aaccacatcgtcgacttcaacctcaagaccaagaaccacaagccgctgcccaaggacgct
gccgactacaccctgtcgcgtctggcccgtctggacaaccagaagggtggcgaatactgc
caggacgtcgccaacgacatccgttcgaccatgcagaagcacgctggcgtgttccgcacc
caggcttcgatggaagaaggcgtcaagaagatcgccgacgtccgcgagcgcgtgaagagc
attggcctgaaggacaactccaaggtcttcaacaccgcccgcatcgaagccctggaagtc
gagaacctcatcgaagctgcccaggccacgatggtgtcggccgccgcccgtccggagtcg
cgtggtgctcatgcccacaacgacttcccgaaccgcgacgacgacaactggatgaagcac
tcgctgtggtactccgaaggcaaccgcctggactacaagcctgtgaacctcaagccgctg
accgtggaatcggtgccgccgaaggtccgtaccttctga

DBGET integrated database retrieval system