KEGG   Aquabacterium olei: DEH84_15325Help
Entry
DEH84_15325       CDS       T05429                                 

Definition
(GenBank) ribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
aon  Aquabacterium olei
Brite
KEGG Orthology (KO) [BR:aon00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aon03016]
    DEH84_15325
Enzymes [BR:aon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     DEH84_15325
Transfer RNA biogenesis [BR:aon03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    DEH84_15325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB
Motif
Other DBs
NCBI-ProteinID: AWI54640
UniProt: A0A2U8FUE4
LinkDB All DBs
Position
3395467..3397527
Genome map
AA seq 686 aa AA seqDB search
MFALFDDAGKFQAGRVMSEADSSMQIELDSGKRVKVKAANVLIKFAKPAPAELLAQAAAQ
SADIDVDLVWEVAPEEDFGFDDLAREYFSASADAVQQAAMLMRLFETPHYFHRRGKGRFK
KAPEDILKQALAAIERKKQQALQIAQWAEALAAGSCPQPIKDQLYKILFKPDKNGAEYKA
VVEAAKAAQRAPLDLLKDAGAIDSPYQFHFKRFLFEHFPKGTGFPALEAPPITDTLPLAA
VQAFSIDDSMTTEIDDALSVQGLGTGTVVYGIHIAAPGLAIAPGSPVDALARGRMSTVYM
PGHKITMLPDDVVQTYTLIEGRDCPAVSLYVTFDEATLAVQGSETKLERVPIAANLRHDQ
LDSVITDATLTGEAPADYAFAPELAFAFRLAKHLKAQREVVRGKPENFNRPDYTFKLIGA
NGVNTMSDGIEPTGTEQVAIGTRQRGSALDLIVAEAMILANSTWGGWLAELGVPGIYRSQ
ASLAPGIKVRMGTKALPHAGMGVAQYTWATSPLRRYVDLVNQWQIVACAKHGRTAALVAP
FKPKDAELFAVISGFDGAYSAYNGFQSSMERYWTLQYLQQQQITELDAAVMVNGLVRADT
LPLVFKAIGADGLPRHARVRVRITGLDALTLDVHASVVARLDDSAPADAGDAEADAEDEL
VDNAGALTLAIDVSDADAPAGDAPAA
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccctgtttgacgacgccggaaaattccaggccggccgcgtgatgtccgaagcc
gacagctcgatgcagatcgagctggacagcggcaagcgcgtgaaggtgaaagccgccaac
gtcctgatcaagttcgccaagccggcgcccgccgagctgctggcccaggccgccgcccag
tcggccgacatcgacgtcgatctggtgtgggaagtggcgcccgaagaggacttcggcttc
gacgatctggcgcgcgagtacttcagtgcctcggccgacgccgtgcagcaggccgccatg
ctgatgcgcctgttcgaaacaccgcactacttccaccgccgcggcaagggccgcttcaag
aaggcgccggaagacatcctcaagcaggcgctggccgccatcgagcgcaagaagcagcag
gctttgcagatcgcgcagtgggccgaggcgctggccgccggcagctgcccgcagccgatc
aaggaccagctctacaagatcctcttcaagcccgacaagaacggcgccgagtacaaggcc
gtggtcgaggccgcgaaggccgcgcagcgcgccccgctcgacctgctgaaggacgcgggc
gccatcgacagcccctaccagttccacttcaagcgcttcctgttcgagcacttccccaag
ggcacgggcttcccggcgctcgaagcgccgccgatcaccgacacgctgccgctggccgcc
gtgcaggccttctcgatcgacgactcgatgaccaccgagatcgacgacgcgctgtcggtg
cagggcctgggcacgggcaccgtggtctacggcatccacatcgcggcgccgggcctggcc
atcgccccgggctcgccggtcgacgcgctcgcgcgcggccgcatgtcgaccgtctacatg
cccggccacaagatcaccatgctgcccgacgacgtcgtgcagacctacacgctgatcgaa
gggcgcgactgcccggccgtgtcgctgtacgtcacgttcgacgaggccacgctggccgtc
cagggcagcgagaccaagctggagcgcgtgcccattgccgccaacctgcgccacgaccag
ctcgacagcgtcatcaccgacgccacgctgacgggcgaggccccggccgactacgccttc
gcccccgagctggcctttgccttccgcctggccaagcacctgaaggcgcagcgcgaagtg
gtgcgtggcaagcccgagaacttcaaccgccccgactacaccttcaagctcatcggcgcc
aacggcgtcaacaccatgagtgacggcatcgagcccaccggcaccgaacaggtggccatc
ggcacgcgccagcggggctcggcactcgacctgatcgtggccgaggccatgatcctggcc
aatagcacctggggcggctggctggccgagctgggcgtgcccggcatctaccgcagccag
gccagcctggcgcccggcatcaaagtgcgcatgggcaccaaggcgctgccgcacgccggc
atgggcgtggcgcagtacacctgggccacctcgccgctgcgccgctacgtcgacctggtc
aaccagtggcagatcgtggcgtgcgccaagcatggccgcaccgccgcgctggtcgcgccc
ttcaagcccaaggatgccgagctgtttgccgtgatctcaggcttcgacggcgcctacagc
gcctacaacggcttccagtccagcatggaacgctactggacgctgcaatacctgcagcaa
cagcagatcaccgagctggatgcggccgtgatggtcaacggcctcgtgcgcgccgacacg
ctgccgctggtgttcaaggccatcggcgccgacggcctgccgcgccacgcccgcgtgcgc
gtgcgcatcaccgggctggacgcgctgacgctggacgtgcacgccagcgtggtggcgcgt
ctggacgacagtgcccccgccgatgcgggtgatgccgaggccgacgcggaagacgagctg
gtcgacaatgccggggccctgaccctggccatcgacgtgagcgacgcggacgcgcctgct
ggcgacgccccggctgcctga

DBGET integrated database retrieval system