KEGG   Aquabacterium olei: DEH84_15655
Entry
DEH84_15655       CDS       T05429                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K07534  cyclohex-1-ene-1-carboxyl-CoA hydratase [EC:4.2.1.-]
Organism
aon  Aquabacterium olei
Pathway
aon00362  Benzoate degradation
aon01100  Metabolic pathways
aon01120  Microbial metabolism in diverse environments
aon01220  Degradation of aromatic compounds
Module
aon_M00540  Benzoate degradation, cyclohexanecarboxylic acid =>pimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:aon00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DEH84_15655
Enzymes [BR:aon01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     DEH84_15655
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AWI55324
UniProt: A0A2U8FY08
LinkDB
Position
complement(3479866..3480648)
AA seq 260 aa
MSQLERPILTATHGRVALITLNRPAQMNALNDALMSALGEALLAFDRDEGIGAIVVTGND
KAFAAGADIAAMADWTYQDVVRDQFVTRNWETIRQVRKPVIAAVAGFALGGGCELALACD
IVIAAESARFGLPEVKLAVLPGAGGTQRLPRAIGKAKAMDLCLTGRMLDAHEAERDGLVS
RVVTPERLMDEAMAVATTIAGFSLPAVMSIKACVNRAWESSLAEGIGFERRELYARFATD
DAREGMHAFLGKRKPVFQHR
NT seq 783 nt   +upstreamnt  +downstreamnt
atgagtcagctcgaacgccccatcctcactgcgacgcacggccgtgtcgcgctcatcacc
ctgaaccgcccggcgcagatgaatgcgctcaacgacgccctgatgagcgccctgggcgag
gccttgctggccttcgaccgtgacgagggcatcggcgccatcgtggtcaccggcaacgac
aaggcgtttgccgccggtgccgacatcgccgccatggccgactggacctaccaggacgtg
gtgcgcgaccagttcgtgacccgcaactgggaaaccatccgccaggtgcgcaagccggtg
attgccgccgtggccggctttgcactgggcggcggttgcgaactggcgctggcgtgcgac
atcgtcatcgcggccgaatccgcccgattcgggctgcccgaagtcaagctggcggtgctg
ccgggcgccgggggcacgcagcgcctgccgcgggccatcggcaaggccaaggccatggac
ctgtgcctgactggacgcatgctcgacgcccacgaggccgagcgcgacgggctggtctcg
cgtgtggtcacgcccgagcggctgatggacgaggccatggccgtggccaccaccatcgcc
ggcttctcgctgcccgctgtcatgagcatcaaggcctgtgtcaaccgtgcctgggaatct
tccctcgccgaaggcatcggcttcgagcgtcgcgagctgtatgcacgcttcgccaccgac
gacgcccgcgaaggcatgcacgccttcctgggcaagcgcaaaccggtgttccagcaccgt
tga

DBGET integrated database retrieval system