KEGG   Aquabacterium olei: DEH84_16800Help
Entry
DEH84_16800       CDS       T05429                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aon  Aquabacterium olei
Pathway
aon00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:aon00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DEH84_16800
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aon02000]
    DEH84_16800
Enzymes [BR:aon01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DEH84_16800
Transporters [BR:aon02000]
 Other Transporters
  Pores ion channels [TC:1]
   DEH84_16800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_N_2 GST_C_2 GST_C_3 2Fe-2S_Ferredox Tom37
Motif
Other DBs
NCBI-ProteinID: AWI54894
UniProt: A0A2U8FWT1
LinkDB All DBs
Position
3753264..3753869
Genome map
AA seq 201 aa AA seqDB search
MKLYFSPGVCSLSPHIVLEESGLPFETEQVDLRKKTTASGADYSEINPKGYVPALVLDNG
VLLTEGPAIVQYLADQVPDKQLAPANGTLARYQLQSWLTFIGTEVHKSFTPFFKPDSTPE
MKDAARANLERRLGYINTELAGREYLLPEGYSVADIYLFVVLGWARLIKLDLTPWPQLQA
FQARVGARPAVQRALKAEGLA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctttatttctcacctggcgtctgctcgctgtcgccgcacatcgtgctggaagaa
tccggtctgccgttcgagaccgagcaggtcgacctgcgcaagaagaccacggccagcggc
gccgattacagcgaaatcaaccccaagggttacgtgccggccctggtgctggacaacggc
gtgctgctgaccgaaggcccggccatcgtgcagtacctggccgaccaggtgcccgacaag
cagctcgccccggccaacggcacgctggcgcgctaccagctgcagagctggctgaccttc
atcggcaccgaggtgcacaagagcttcacgcctttcttcaagcccgactccacgcccgag
atgaaggatgccgcgagggccaacctggaacggcgtctgggctacatcaacaccgaactg
gctggccgcgaatacctgctgcccgagggctacagcgtggccgacatctacctgttcgtc
gtgctgggctgggcccggctcatcaagctggacctgaccccgtggccccagctgcaggcc
ttccaggcccgcgtgggcgcacgcccggcggtgcagcgggcgctgaaggccgaaggactg
gcgtaa

DBGET integrated database retrieval system