KEGG   Aquabacterium olei: DEH84_18180Help
Entry
DEH84_18180       CDS       T05429                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aon  Aquabacterium olei
Pathway
aon00564  Glycerophospholipid metabolism
aon01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DEH84_18180
Enzymes [BR:aon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DEH84_18180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 Pyr_redox_2 FAD_binding_2 Lycopene_cycl NAD_binding_8 TrkA_N 3HCDH_N FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AWI55513
UniProt: A0A2U8FWV6
LinkDB All DBs
Position
pTB101:complement(181901..183484)
Genome map
AA seq 527 aa AA seqDB search
MVHETRVPPSQEVDVLIVGGGINGAGIARDLAGRGWSVCLVEQDDLASHTSSASTKLIHG
GLRYLEHRAFGLVRKALSEREVLLRSAPHIMWPLQFVLPHDPGMRPAWLIRLGLFLYDHL
ARRDVLPASRSVDLRRSPLGAPLQPRLQQGFVYADGWVDDARLVVLNALDAQAHGAVIRT
RTRCTQARREARHWVVTVEESDGRAATVRARALVNAAGPWAERLLRQVTQPAGVEPLITR
HLRLVKGSHIVVPRCFEHDHAYLFQNPDGRILFAIPYEGAFTLIGTTDQEIHGDPRDARA
DDAEVAYLCEQASRYLARPVTPADVVWRYSGVRPLLDDAHGNPAAVTRDYRLETDDLAAP
LLTVWGGKITTFRQLAEDAGNALGHMLHENRPAWTRGACLPGGDLSGWIDVSGHPARDFA
RFLQAVQDRHPWLPPALAQRLARAYGSRIERVLCGARNVDALGEPCAPGLYEAELSYLRD
EEWARTADDVLWRRSKLGLHLTEAQRADVASWFTRATLLGHTQAWTP
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggtccatgaaacgcgggtgccgccatcccaagaggtcgacgtcctgattgtcggaggg
ggcatcaacggtgccggcattgcccgtgatctggccggacgcggctggtcggtgtgtctg
gtcgagcaggacgacctcgcctcgcacacctcgtcggcatccaccaagctcatccacggc
gggctgcgctatctcgagcaccgcgccttcgggctggtgcgcaaggccctgtccgagcgc
gaggtgttgctgcgctcggcgccgcacatcatgtggccgctgcagttcgtgctgccgcac
gacccgggcatgcgcccggcctggctgatccggctgggcctgttcctgtatgaccacctc
gcgcggcgcgatgtgctgcccgcctctcgttcggtcgacctgcgccggtcgccgctgggt
gcaccgctgcagccgcgtctgcagcaaggctttgtgtacgccgacggctgggtggacgat
gcccgactggtcgtgctcaatgcgctggacgcacaggcccacggcgcggtgattcgcacg
cgcacccgctgcacccaggcccggcgcgaagcgcggcactgggtggtcacagtggaagag
tccgacggtcgcgcggccaccgtgcgggcccgcgccctggtcaacgcggcaggcccctgg
gccgagcgcctgttgcgtcaggtgacccagcctgccggcgtcgaaccgctgatcacgcgc
cacctgaggctggtcaagggcagccacatcgtggtgccgcgctgcttcgagcacgaccat
gcctacctgttccagaaccccgatgggcgcatcctgttcgcgatcccgtacgaaggcgcc
ttcaccctgatcggcaccacggaccaggagatccacggtgacccgcgcgatgcccgggcc
gatgacgccgaggtggcctacctgtgcgagcaggccagccgctatctggcccggccggtc
acccccgccgatgtggtgtggcgctacagcggggtgcggccgctgctggatgatgcccac
ggcaacccggctgcggtgacgcgcgactaccgcctggagaccgatgacctggccgcgccg
ctgctgacggtgtggggcggcaagatcaccaccttccggcaactggccgaagacgcgggc
aacgccctcggccacatgctgcacgagaaccggcccgcctggacccggggtgcctgcctg
cccggtggcgatctgtcgggctggatcgacgtgagcggccaccccgcgagggacttcgcc
cgcttcctccaggctgtccaggaccggcacccctggctgccgcccgcgctggcccaacgc
ctggcgcgtgcctatggctcacgcattgagcgggtgctgtgcggtgcgcgcaacgtggat
gccctcggtgagccgtgcgccccggggctgtacgaggccgagctcagctacctgcgcgac
gaggagtgggcgcgcacggcggacgacgtgctctggcgtcgcagcaagctcggcttgcac
ctcacggaagcccagcgcgccgacgtggcttcgtggttcacccgtgcgacgcttctcggg
cacactcaggcatggacaccctga

DBGET integrated database retrieval system