KEGG   Aspergillus oryzae: AO090001000710Help
Entry
AO090001000710    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
aor  Aspergillus oryzae
Pathway
aor00010  Glycolysis / Gluconeogenesis
aor00051  Fructose and mannose metabolism
aor00052  Galactose metabolism
aor00500  Starch and sucrose metabolism
aor00520  Amino sugar and nucleotide sugar metabolism
aor01100  Metabolic pathways
aor01110  Biosynthesis of secondary metabolites
aor01130  Biosynthesis of antibiotics
aor01200  Carbon metabolism
Module
aor_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aor_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AO090001000710
   00051 Fructose and mannose metabolism
    AO090001000710
   00052 Galactose metabolism
    AO090001000710
   00500 Starch and sucrose metabolism
    AO090001000710
   00520 Amino sugar and nucleotide sugar metabolism
    AO090001000710
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AO090001000710
Enzymes [BR:aor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     AO090001000710
Membrane trafficking [BR:aor04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    AO090001000710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 5991173
NCBI-ProteinID: XP_001819202
UniProt: Q2UML5
LinkDB All DBs
Position
2
AA seq 490 aa AA seqDB search
MVGIGPKRPPSRKGSMHELPQNLLEQIKQFEDIFTVDGAKLKQIADHFVKELEKGLSVEG
GNIPMNVTWVMGFPDGDEQGTFLALDMGGTNLRVCEITLTEEKGAFDITQSKYRMPEELK
TGTAEELWEYIADCLQQFIESHHENEKLSKLPLGFTFSYPATQEYIDHGVLQRWTKGFDI
DGVEGQDVVPPLEAILKKRGLPIKVAALINDTTGTLIASSYTDSDMKIGCIFGTGVNAAY
MEHCGSVPKLAHKNLPPDMPVAINCEYGAFDNEHVVLPLTKYDIIIDRDSPRPGQQAFEK
MTAGLYLGEIFRLALLDLLETRPGLIFQGQDTSQLRKPYLLDASFLAAIEDDPYENLQET
QELMERKLNIKATQQELEMIRRLAELIGTRAARLSACGVAAICKKKNIESCHVGADGSVF
TKYPHFKARGAQALREILDWAPNEKDKVVIMAAEDGSGVGAALIAALTLKRVKAGISCGI
RDMADMQSLI
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggttggaattggccccaaacgtcccccatcccgcaagggatcgatgcatgagctgccc
cagaacctgttggagcagatcaagcaattcgaggacatctttaccgtggacggcgccaaa
ctcaagcagattgcggaccatttcgtgaaggagctcgaaaagggtctaagcgtcgagggg
ggtaacattcccatgaatgtgacctgggtcatgggattccccgatggcgacgagcaggga
accttcctcgctttggacatgggcggtactaatctgcgtgtctgtgagatcactttgacg
gaagagaagggcgctttcgacatcacccagtccaagtatcgtatgccggaggagttgaag
acgggtacagcggaggagctttgggaatacatcgccgactgtttgcagcagtttattgaa
tcccaccacgagaatgagaaactgtctaaactgccattgggctttaccttctcctatcct
gctacacaggaatacattgatcatggtgttctccagcgttggacaaagggtttcgacatt
gacggagtagagggccaggatgttgtgcccccattggaggcaatcctcaagaaaagaggc
cttcctatcaaagttgctgcgttgatcaacgacactacgggcaccctgatcgcctcttct
tacaccgactcagatatgaaaattggctgcattttcggcactggtgtcaacgccgcctac
atggaacattgtggctcggttcccaagcttgcacacaagaatctacccccagacatgccc
gtggccatcaactgcgagtacggtgcctttgacaatgagcacgttgttctgcccctcacg
aagtatgatatcatcatcgaccgcgactcccctcgcccaggacaacaagctttcgagaag
atgactgcaggtctttacttgggagaaatattccgtctagccctcttggatctgttggag
acgaggcctggtctgattttccagggccaagacacatcccagctccggaaaccttacttg
ctggacgcgtccttcctcgcagctattgaggatgatccgtacgagaacttgcaggaaact
caggagctcatggagcgcaagctgaacatcaaggccacccagcaggagctggaaatgatc
cgtcgcttggcggagttgatcggcactcgtgcagctcgtctgtcggcgtgtggtgtggct
gccatctgcaagaagaagaacattgagtcttgccatgtgggcgccgacggctctgtcttt
acgaaatatccccacttcaaggcccgtggagcacaggctctgcgcgagatcttggactgg
gcacctaacgagaaggacaaggtggtcatcatggctgctgaagacggttctggtgttgga
gcggctcttattgctgcattgacattgaagcgggtcaaggcaggcatcagctgcggtatc
cgagatatggccgatatgcagagtctcatttaa

DBGET integrated database retrieval system