KEGG   Aspergillus oryzae: AO090003000666Help
Entry
AO090003000666    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; glutamate decarboxylase and related proteins
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
aor  Aspergillus oryzae
Pathway
aor00250  Alanine, aspartate and glutamate metabolism
aor00410  beta-Alanine metabolism
aor00430  Taurine and hypotaurine metabolism
aor00650  Butanoate metabolism
aor01100  Metabolic pathways
aor01110  Biosynthesis of secondary metabolites
Module
aor_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AO090003000666
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AO090003000666
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AO090003000666
   00430 Taurine and hypotaurine metabolism
    AO090003000666
Enzymes [BR:aor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AO090003000666
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase Polysacc_deac_2
Motif
Other DBs
NCBI-GeneID: 5991801
NCBI-ProteinID: XP_001819818
UniProt: Q2UKU9
LinkDB All DBs
Position
2
AA seq 570 aa AA seqDB search
MAVSPPSRRAEEVRSLLSAVEDLLIPFIRSADEDPLGQKALENGVNGANGTHNDLKPSGT
SLVDHKKPEELQSILQLELPEQGTGQDGLVEALQKVLRYSVNTWHQGFLDKLYASTNAPG
VASELILAALNTNVHVYQVSPALTVIEKFTGKQLASLFGLKGPRAGGISVQGGSASNTTS
IVIARNNLFPATKRDGNGDYRFVLFTSAHGHYSIEKAAQMLGLGSSSVWSVPIDKQGRMI
PAELENLVRKALKENRTPFYVNATAGTTVMGSFDPFDEIAAICKKYNLWFHVDGSWGGSF
VFSKRQRQKLAGAEKADSIAINPHKMLGVPVTCSFLLAADLRRFHRANTLPAGYLFHNED
TELPEANGCNGAVESELSVDSPEVWDLADLTLQCGRRADSLKLFLGWTYYGTAGYEKQID
AACDIAAHLATLVAENPNFILVSENPPPCLQVCFYYAPGGQFLHPRGVVSDEAERGKANS
KVTEQVTHAIVSKGFMVDFAPPSGDDDVVGNGKFFRCVVNVQTTKETVEALLQAIEEVGP
GIVENMKVQKAQRKFNRPGERGHGPVVHHP
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggctgtttcccccccgtcccgccgcgcggaagaagtgcgaagtctgctaagtgcggtc
gaagacctcctaatccccttcatccggtcggcagatgaagatcccctaggccagaaggca
ttggaaaatggcgtcaatggagccaacggcactcataacgacctcaaaccatcgggtact
tcgttagtggaccacaagaaaccggaggaactgcagagcattcttcaattggagctgcca
gagcaaggaacaggacaagatggcctggtcgaggctctgcagaaggtcttgcgatactca
gtcaacacttggcaccagggcttccttgacaagctgtatgcatccaccaacgcccccggt
gtagcttctgagcttatcttggccgccttgaacacaaacgtccacgtctaccaggtctcg
cccgctttgacagtcattgagaaattcaccgggaaacagctggcttcgctttttggtctc
aaaggtccacgagcgggaggaatatcggtccaaggcggttctgcctcgaatacaacgtca
attgtcattgcacgcaacaatcttttccctgctacgaaaagagacggaaacggcgattac
cgattcgtgttattcaccagcgcccatggccattacagcattgagaaggcagcacagatg
ctagggcttggcagtagctcggtttggtctgtacctatcgacaagcaaggacgcatgatc
ccggcggagctggagaacttagttcgaaaggctctgaaggagaaccgtaccccgttctac
gtcaatgcgacagcggggacaaccgttatgggatctttcgacccgtttgacgaaatcgcc
gccatctgcaagaaatataatctgtggttccatgttgacggctcctggggtggctcgttt
gtcttctccaaacgccaacgacagaagctcgccggggcagaaaaggcagacagcatcgcg
atcaaccctcacaaaatgctcggtgtgccggtgacttgctcattcctccttgcggccgat
ttgcgtcgcttccaccgtgcaaacacccttcctgctgggtatctgttccacaacgaagac
accgagcttcccgaagccaatggctgtaatggcgccgtcgaatctgaactcagcgttgac
tcgcccgaagtatgggacctggcggatctgacccttcagtgcggtcgacgtgccgattcc
cttaagctcttcctcggctggacttattacggaacagcggggtacgagaagcagattgac
gctgcctgcgacattgcagcgcatctcgcaaccctcgttgccgagaaccctaacttcatc
ctcgtcagtgagaatcctcctccatgcctccaagtttgcttctattacgcccccggcggg
caattcctccatcctcgtggcgtcgtctcggacgaagccgagcgcggcaaagccaacagc
aaggtcaccgagcaggtgacgcatgcgattgtgagcaagggcttcatggttgattttgcg
ccacccagcggtgatgatgatgtcgtcggaaatgggaagttcttccgttgcgtagtaaat
gtgcagactacaaaggagaccgttgaagcgctgttacaagcaattgaggaagttggtccg
ggtatagttgagaacatgaaggtgcagaaagctcaaaggaaatttaatagaccgggagaa
aggggccacggtccagttgttcaccacccttga

DBGET integrated database retrieval system