KEGG   Aspergillus oryzae: AO090003000668Help
Entry
AO090003000668    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; ATP-dependent DNA ligase I
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
aor  Aspergillus oryzae
Pathway
aor03030  DNA replication
aor03410  Base excision repair
aor03420  Nucleotide excision repair
aor03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:aor00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AO090003000668
   03410 Base excision repair
    AO090003000668
   03420 Nucleotide excision repair
    AO090003000668
   03430 Mismatch repair
    AO090003000668
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aor03032]
    AO090003000668
   03400 DNA repair and recombination proteins [BR:aor03400]
    AO090003000668
Enzymes [BR:aor01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AO090003000668
    6.5.1.6  DNA ligase (ATP or NAD+)
     AO090003000668
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     AO090003000668
DNA replication proteins [BR:aor03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    AO090003000668
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     AO090003000668
DNA repair and recombination proteins [BR:aor03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     AO090003000668
   NER (nucleotide excision repair)
    Other NER factors
     AO090003000668
   MMR (mismatch excision repair)
    Other MMR factors
     AO090003000668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 5991803
NCBI-ProteinID: XP_001819820
UniProt: Q2UKU7
LinkDB All DBs
Position
2
AA seq 827 aa AA seqDB search
MSSPAKKRKRDVPVSSPYRNRSIASFFQGQAAKQADNAEQTPSTVSEDTDQTLSDEALAR
KLQEEWNRQDAAPASDTQAPTGEPFATPSNTKDDELEPPNKTQKRNTLSLQSSTGTEDTI
SLAVPFDQSPLTFDSTKCAEELKGHWAATGGDASYALLTRAFVLANATTSRIKIVDTLVN
FLRVLIEADPSSVLPAVWLATNSISPPYDELELGLGGSSISKALKKIYGLNSQGLKSLYD
KLGDAGDVAFEAKKRQSFTLMKPKPLTVKGVYQSLQKIAMSKGTGSQETKQRIVEKLLQD
TRGAEESRYIVRTLVQNLRIGAVKITMLIALARAFLYSKPEGADFAVRSQQELACLKKED
LAEIYNNAEEIVKASYARHPDYNDLVPCLLEIGVTEELLVRCGLQLHIPLRPMLGSITRD
LSEMLTKLQGRDFTCEYKYDGQRAQVHCDENGKVSIFSRHLENMTEKYPDLVSLVPQIRG
ESVSSFILEGEVVAVDQETGELQAFQILTNRAKKNVDIGTIKINVCLFSFDLMYLNGTPL
LDRPFRERRELLRSLFVEIPNRFTWVKSFDATSADSEAVLEFFKGATDTKCEGIMVKVLD
NVSKSNNPEPSETPNNDIDKPDPKPAKGGRRKALLSTYEPDKRLESWLKVKKDYSTSSET
LDLIPVGGWHGQGRKAKWWSPILLAVRNPETGSLEAVTKCMSGFTDKFYQANKDKYTEGS
PNVISRPSYVEYYGEPDVWFEPQEVWEMAFADITLSPTYTAAIGLVSDERGLSLRFPRFL
RVREDKSIDEATTSDYLALLWRKQFERSQKEEAKPPAPDAELGWQEE
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atgtctagcccggccaaaaagcgcaagagagatgtccccgtctcatccccctaccgcaat
cgaagcatagcgtcattcttccagggccaagcagccaagcaagctgataatgcggagcag
actccgtcaactgtgtctgaagatacagaccaaactctttccgatgaagctctcgcccgc
aagctccaagaagaatggaaccggcaagatgctgccccggcttcagatactcaggcacca
actggtgaacccttcgcaacgccgtcgaacaccaaagacgacgaactagagccgccaaac
aagacacagaagaggaatacactatcgttgcagtcttctaccggcacagaagacaccatt
tctcttgcagtgccttttgatcaaagtcccttgacattcgactcaacgaaatgtgcagag
gagttaaaagggcactgggctgccacaggtggcgatgcttcatatgctctcttaaccaga
gcctttgtacttgcaaatgccacaacaagccgcatcaaaattgtggatacactcgttaac
ttcctgcgagtgctcattgaagccgacccttcgagtgtcctccctgcagtatggctagca
accaactcgatctctccaccatacgatgagttggagctaggactcggtggatcttctatt
tcgaaggcattgaagaagatatatggactcaatagccaagggctcaaatcgctgtatgac
aaacttggagacgccggtgatgtggcgttcgaagctaaaaagagacagagcttcacgtta
atgaagcccaaaccattgacggtcaaaggggtatatcagtccctgcaaaagattgcgatg
agcaagggcacaggaagccaggaaactaaacagagaatcgtcgagaaactgttgcaggat
actaggggcgcggaagaaagccggtatattgtgaggacgctcgtccaaaacttgcgaata
ggagctgtaaagattaccatgctcatcgcactcgcccgcgctttcctgtactctaaaccg
gaaggcgccgatttcgctgtccgttcccaacaagagttggcttgtctgaaaaaggaagac
ctggctgaaatttacaacaatgcagaggagattgtcaaggcttcatatgctagacatcct
gattacaatgatctagttccctgtttgctcgagataggggtcacggaagaactccttgta
cgatgtggcctacaactacatataccgttgaggccaatgttaggcagcatcactcgggac
ctctccgagatgttgacgaaacttcaaggacgggattttacctgcgaatacaaatatgac
gggcagcgtgcccaagtgcactgtgacgagaatggcaaagtatcgatattctctcgtcat
ctggaaaatatgacagagaaatacccggacctggtgtccctggttccgcagattagaggc
gagagcgtgtcgagcttcatactagagggtgaagtagtcgccgtggaccaggaaacgggg
gaactccaagcctttcagattttgaccaaccgagccaaaaagaacgttgatataggaact
atcaagattaatgtttgtctcttttcatttgacctgatgtacctgaacggaacccctttg
ttggatcgacctttccgcgaacgtagagaacttctacgaagcttattcgtggaaatcccg
aaccggttcacatgggtaaagagttttgatgccacatctgccgattctgaggccgtcctg
gaatttttcaaaggtgcaactgataccaagtgcgaaggcatcatggtcaaggtgctcgac
aatgtgtcgaagtcaaataacccggaaccatcagagaccccaaacaacgacatagacaaa
ccggatccaaaacccgcgaaaggaggccgccgaaaggccttactttccacatacgaacca
gacaaaaggcttgaatcctggctcaaagtcaaaaaggattacagcacctcatccgagacc
ctcgacctgatccccgtcggaggctggcacggacaaggccggaaagccaaatggtggtca
cccatcctgttagctgtacggaatcccgaaaccggcagcctcgaagccgttacaaagtgt
atgtccggcttcacggacaagttctaccaggccaacaaggataaatacaccgaaggcagc
cccaacgtgatctcacggcccagctacgtcgaatactacggcgagccggacgtctggttc
gagccgcaggaggtgtgggagatggcctttgcagatatcacactcagcccgacttacacg
gctgccatcgggctggtgagcgatgaacgaggtcttagtcttcggtttcctcggtttctt
cgcgtccgcgaggacaagtccattgatgaggctaccacgtcggactacctagccttactg
tggaggaagcagttcgaacgttcccagaaagaagaagcgaaaccccctgctccagatgct
gagctaggttggcaggaggagtga

DBGET integrated database retrieval system