KEGG   Aspergillus oryzae: AO090003001039Help
Entry
AO090003001039    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; predicted protein
Organism
aor  Aspergillus oryzae
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 5992130
NCBI-ProteinID: XP_023090194
LinkDB All DBs
Position
2
AA seq 305 aa AA seqDB search
MIAEGAANDAGAVLGAESMSSGNAVFPPPDDPEPRDRQPFGVLTPNPPLPEGHPGANGQR
FFTIQRVNGNGANGKNDGVSGGHRHTLEESDRVKKNSVQRYLLKEAREKKKASSQSIIPA
SLFPFPRFLTSCCMVSFSMFLRSLFQTQRQRLLSYLEFPAICLPPAVYSRSLIQPAQKVR
AMSTQNQPSQKTYHTKATGLAALTVSNHSSENELKLYGSCFCPFVQRVWIALEAKGIPYQ
YIEVDPYKKPQSLLEVNPRGLVPALRHGDWGSHESTVLLEYVSNPTTLKRVKPDETLTLS
CSLKT
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgattgcggaaggcgccgccaatgacgccggggcggttctgggcgcggagtcaatgtcc
agcggaaatgcggtgtttcctccacctgacgatccggagcctcgagatcgccagccattt
ggtgtgctgacgcctaatccgccgttgcctgaaggtcatcctggggccaatggacagcgg
ttctttaccatccagcgagttaacggcaacggcgccaatgggaagaatgacggggtcagc
ggtgggcatcggcatacattagaagagagtgatcgggtgaagaagaatagtgttcagcgg
tatttgctgaaggaggcgagagagaaaaagaaggcaagttcgcaatcaatcattcctgcg
tctctctttccttttccccgctttctcacaagttgttgcatggtttcattttcaatgttc
ctcagatcccttttccaaacacaaagacagcggctgttatcctacctggaatttcccgcc
atttgtttaccaccagctgtctattctcggagtctaattcaacccgcccaaaaggtcagg
gcaatgtctacccaaaaccaaccttcgcagaagacctatcacacaaaagccaccggcttg
gctgccctgacggtgtctaaccattccagcgagaatgaattgaaactgtacggcagctgt
ttctgtcccttcgtgcagcgtgtatggatagccttggaggccaagggcattccgtatcag
tatatcgaggtagacccctacaaaaagcctcagtccctattggaggtgaacccaaggggc
cttgtccctgccctgcggcacggagattgggggtcacatgaaagtactgttttgctagaa
tatgtatcaaaccccacaactttgaagcgagtcaaaccagatgagacactgacactttca
tgcagcttgaagacttga

DBGET integrated database retrieval system