KEGG   Aspergillus oryzae: AO090003001055Help
Entry
AO090003001055    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
aor  Aspergillus oryzae
Pathway
aor00020  Citrate cycle (TCA cycle)
aor00310  Lysine degradation
aor00380  Tryptophan metabolism
aor01100  Metabolic pathways
aor01110  Biosynthesis of secondary metabolites
aor01130  Biosynthesis of antibiotics
aor01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AO090003001055
  09105 Amino acid metabolism
   00310 Lysine degradation
    AO090003001055
   00380 Tryptophan metabolism
    AO090003001055
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AO090003001055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 5992142
NCBI-ProteinID: XP_023090198
LinkDB All DBs
Position
2
AA seq 1019 aa AA seqDB search
MLPRMPSVAQARLILQSTSGDHHITSRSNKTVLKDPNDSFLSGNTANYIDEMYLAWKKDP
SSVHISWQTYFKNMEDGNMPVSQAFQPPPTIVPTPTGGVPQTMPGAGLSMAAGTDVTNHL
KVQLLVRAYQARGHHKAKIDPLGIRGEAEAFGYNKPKELELDHYGFTERDLDEEFTLGPG
ILPRFATESRKKMTLREIIATCESIYCGSYGVEYIHIPDRKPCDWIRDRFEIPEPYKYSV
DDKRRILDRLIWSHSFESFLATKFPNDKRFGLEGCESLVPGMKALIDRSVDYGIKDIVIG
MPHRGRLNVLSNVVRKPNESIFSEFAGSAEPSDEGSGDVKYHLGMNFERPTPSGKRVQLS
LVANPSHLEAEDPVVLGKTRSIQHYNKDEKNFDSAMGVLLHGDAAFAGQGVVYETMGFHS
LPAYSTGGTIHIIVNNQIGFTTDPRYSRSTPYCSDIAKSIDAPVFHVNGDDVEAVNYVCQ
VAADWRAEFKSDVVIDIVCYRKQGHNETDQPSFTQPLMYKRIAAQKNQLDKYVEKLITEG
TFTKEDIDEHKKWVWGMLNDSFDRSKDYQPTGKEWLTSAWNGFKTPKELATEVLPHLPTG
VEGPLLKHVADKVSGAPDGFTLHRNLKRILSNRKKAVDEGKNIDWATAEALAFGSLVSEG
YHVRVSGQDVERGTFSQRHAVLHDQENENTYTPLQHISEDQGSFVISNSSLSEFGALGFE
YGYSLTSPNALVMWEAQFGDFANNAQCIIDQFIASGESKWLQRSGLVVSLPHGYDGQGPE
HSSGRMERWLQLCNEEPRIFPSQDKLDRQHQDCNMQIAYMTEPANLFHILRRQIHRQFRK
PLVIFFSKALLRHPIARSDIEDFSGDSHFRCIIPDPAHGSAIDEPEKIERVILCSGQVYA
SLLKHREANGIRNTAITRIEQLHPFPWAQLKENLDSYPNARNIVWAQEEPLNAGAWSYTQ
PRIETLLNETEHHNRRHVLYAGRSPSASVATGLKGVHLKEEQEFLEEAFSVHQERLKGE
NT seq 3060 nt NT seq  +upstreamnt  +downstreamnt
atgctcccccggatgccttcggtggcacaagcgcgactgattctccaatcgacaagtggg
gaccaccacataacctctcgcagcaacaaaacagtattgaaggatcccaatgattccttc
ctctcgggcaacactgcaaactatatcgacgagatgtacctggcgtggaagaaggacccg
tcaagcgtccacatctcgtggcagacctacttcaaaaacatggaggacggtaacatgcct
gtctcacaggccttccaaccacccccgacaattgtccctaccccgaccggtggtgttccc
caaaccatgcctggcgctggtctgtccatggctgccggtaccgacgtcacgaatcacttg
aaggttcagctactcgttcgcgcctaccaggcacgtggtcaccacaaggctaagatcgac
cctctgggtatccgtggcgaggctgaggcctttggctacaacaagcctaaggaactcgag
cttgatcattatggatttaccgagcgtgatctggatgaggagttcacccttggacccggt
attctgccgcgtttcgctaccgagagccgcaagaagatgaccttgcgcgaaatcatcgcc
acctgtgagagtatctactgtggctcttacggcgttgagtacatccacattcctgatcgc
aagccttgtgactggatccgtgatcgcttcgagatccccgagccttacaagtactctgtt
gatgacaagcgccgcattctcgaccgtctcatttggagtcacagcttcgaatccttcctt
gccaccaaattccccaacgacaagcgtttcggtctcgagggctgtgaatcgctcgtccct
ggtatgaaggccttgatcgaccgcagtgttgactacggtatcaaggacattgtcatcggt
atgccccaccgtggccgtctcaatgtcctgtccaacgtcgtccgtaagccgaacgagtcc
atcttcagtgagttcgctggctccgctgagccatccgatgaaggctctggtgatgtcaag
taccacttgggtatgaacttcgagcgccctactccctctggtaagcgtgtccaattgtct
ctggttgccaacccgtcccacttggaagccgaagaccccgtcgtgctcggaaagacccgc
tctatccagcactacaacaaggatgagaagaatttcgactctgctatgggagtgttgctg
cacggtgatgctgcatttgctggccagggtgtcgtgtacgagaccatgggcttccactcc
ttgcctgcttactccactggcggtaccattcacatcatcgtgaacaaccagattggtttc
actaccgatcctcgttattcccgttccaccccctactgctcggacatcgccaagtcgatt
gatgcccctgtcttccacgtcaacggtgatgacgtcgaggccgtgaattatgtctgccag
gttgccgcggactggcgtgcggagttcaagagcgatgtcgtcattgacattgtctgctac
cgtaagcagggtcacaacgagaccgatcagccgtctttcactcagcccttgatgtacaag
cgtattgccgctcagaagaatcagcttgacaagtatgtcgagaagttgatcaccgagggt
accttcactaaggaggacatcgatgagcataagaagtgggtctggggaatgcttaacgac
agctttgaccgtagcaaggactaccagcctactggcaaggaatggttgacctccgcatgg
aacggattcaagacccccaaggagttggccaccgaggttctgcctcacctgcccactggt
gttgagggccctcttctgaagcacgttgctgacaaggttagcggtgctccggatggcttt
actctgcaccgtaacctcaagcgtattttgtccaaccgcaagaaggctgtggatgagggc
aagaacatcgactgggctactgccgaggctcttgctttcggctccctcgtttcggaaggc
taccatgtccgtgtctccggtcaggatgtcgagcgtggtactttctcccagcgccatgcc
gttctgcatgaccaggagaacgagaacacttatacccctctgcagcacatctccgaggat
cagggcagcttcgtcatctctaactcctctctgagtgaatttggagcccttggattcgaa
tacggttactccttgacctcccctaacgccctcgttatgtgggaagcgcagtttggtgac
tttgccaacaacgctcagtgcattattgaccagttcattgcctcgggagaatccaagtgg
ttgcaacgctccggtcttgttgtctccctgcctcatggttacgatggccagggcccagag
cactcctccggcagaatggagcgctggttgcagctctgtaacgaggaacctcgtatcttc
ccctctcaggacaagcttgaccgccagcaccaagactgcaacatgcagattgcgtacatg
accgaacccgccaacctgttccacatcctgcgtcgtcaaatccaccgccagttccgcaag
cctcttgtgattttcttctcgaaggcactcctccgtcatccgattgcccgctctgatatt
gaggacttctctggcgactctcacttccggtgtatcatccctgaccccgctcacggctct
gccattgatgaacctgagaagattgagcgtgtcatcctgtgctccggacaagtctacgct
tctctgctgaagcaccgtgaggcgaatggcatccgcaacactgctatcactcgtatcgag
cagctccaccccttcccttgggcacagctcaaggagaacctcgacagctaccccaacgcc
cgcaacattgtctgggctcaagaagagcctctgaatgcgggtgcctggagctacacccag
cctcgcattgagactctgctgaacgagaccgagcaccacaaccgtcgccatgtcctctac
gctggtcgttcccccagtgcatccgtggccactggtctcaagggtgttcatctcaaggaa
gagcaggagttcctcgaggaggccttctctgttcaccaggagcggttgaagggtgagtaa

DBGET integrated database retrieval system