KEGG   Aspergillus oryzae: AO090003001062Help
Entry
AO090003001062    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; manganese superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
aor  Aspergillus oryzae
Pathway
aor04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:aor00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AO090003001062
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AO090003001062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 5992149
NCBI-ProteinID: XP_001820166
UniProt: Q2UJV1
LinkDB All DBs
Position
2
AA seq 230 aa AA seqDB search
MAASLIRTSARTALRAGASATPKAAGVAGLTFARGKATLPDLAYDYGALEPSISGKIMEL
HHKNHHQTYVNSYNTAIEQLQEAVAKEDITTQINLKPLINFHGGGHINHTLFWENLAPKS
QGGGEPPSGALAKAIDESFGSLGEFQSKMNAALAGIQGSGWAWLVKDKQTGNIGIKTYAN
QDPVVGQFQPLLGIDAWEHAYYLQYQNRKAEYFSAIWDVINWKAVEKRFS
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctctcttatccgtacctctgcccgtaccgctcttcgcgctggagcttcggct
actcctaaagctgcgggtgttgcgggtttgacctttgcccgtggcaaggccactctgcct
gacctggcttatgactatggcgcccttgagccctctatctccggaaagatcatggagctt
caccacaagaaccaccaccagacctatgtcaacagctacaacaccgccatcgaacagctc
caggaggccgtcgccaaggaggacatcaccactcagatcaacctcaagcccctgatcaac
ttccacggtggtggccacatcaaccacactcttttctgggagaaccttgcccctaagagc
cagggcggtggtgagcccccatctggagctttggccaaggccatcgacgaaagcttcggc
agcttgggagagttccagagcaagatgaacgccgccctcgctggtattcagggaagcgga
tgggcttggctcgtcaaggacaagcagaccggaaacatcggcatcaagacctatgccaac
caggaccctgtcgttggtcagttccagcctcttctcggtattgatgcttgggagcacgcc
tactaccttcaataccagaaccgcaaggctgagtacttcagcgccatctgggacgtcatc
aactggaaggcggttgagaagcgcttctcgtaa

DBGET integrated database retrieval system