KEGG   Aspergillus oryzae: AO090005001084Help
Entry
AO090005001084    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; maltase glucoamylase and related hydrolases, glycosyl hydrolase family 31
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
aor  Aspergillus oryzae
Pathway
aor00052  Galactose metabolism
aor00500  Starch and sucrose metabolism
aor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AO090005001084
   00500 Starch and sucrose metabolism
    AO090005001084
Enzymes [BR:aor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     AO090005001084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 5990005
NCBI-ProteinID: XP_001818060
UniProt: Q2UQV7
LinkDB All DBs
Position
1
AA seq 877 aa AA seqDB search
MLGSLLLLAPLAGAAVIGSRADTQQCPGYKASNVQENDRSLTADLTLAGKPCNTYGTDLH
NLKLLVEYQTDERLHVKIYDAEERVYQVPEKVTPRVDSGDGSSKDSALKFEYEEEPFSFT
VKRDDEVLFDSSAENLIFQSQYLKLRTWLPENPYLYGLGEHTDPLRLSTTNYTRTFWNRD
AYGTSANSNLYGTHPVYYDHRGESGTHGVFLLNSNGMDVFIDKTADGKQYLEYNALGGIF
DFYFFTGSNPKEASIEYSKIVGLPAMQSYWTFGLHQCRYGYRDVYQVAEVVYNYTKAGIP
LETMWTDIDYMDRRRVFSLDPDRFPLEKMRELVGYLHDHDQHYIVMVDPAVSVSDNGAFN
RGLEQDVFLKTQNGSLYKGAVWPGVTAYPDWFHPDIQDYWNSEFSTFFNAETGVDIDGLW
IDMNEASNFCPDPCTDPERYSSENNLPPAPPPVRSSSPRPLPGFPADFQPSSASRSQKRI
VKAKVGLEGRDLLNPPYKIRNEAGSLSNKTINTGIVHAGEGYAEYDTHNLYGTMMSSSSR
EAMQYRRPEVRPLVITRSTYAGAGRDVGHWLGDNFSKWEHYRISIAEGLAFASMFQVPMV
GADVCGFAGNTTEELCARWASLGAFFTFYRNHNEIGNIGQEFYVWPTVAESARKAIDIRY
RLLDYIYTSFYKQSQTGEPFLQPVFYLYPEDENTFSIDLQFFYGDAILVSPVPDKGLTSV
DAYFPDDIFYDWYTGTPVRGHGANITLSNIDITHIPLHIRGGSIIPIRSSSAMTTTELRE
KSFQLIIAPGLDGTASGSLYLDDGDSLEQKATLEVEFEYRKGVLHIDGKFELHASLVESV
TLLGQGKGGSRARREDGTKKTIQTNLELSKPTEIKLE
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgttgggttctctcctacttcttgcccccttggcgggagctgccgtgattgggtcacga
gcggacacccagcagtgccctggatacaaggcatccaatgtccaggaaaatgatcggtct
ttgacggccgacttgaccctcgcaggaaaaccctgcaacacctatggcaccgatctgcat
aacctcaagcttctggtagaataccaaactgatgagcgtcttcatgttaagatatatgac
gccgaagaacgtgtataccaggtacctgaaaaggtgacccctcgagtagacagtggcgat
ggttctagtaaagactccgcacttaaatttgaatacgaggaagagcccttttcgtttacc
gtgaaaagagatgatgaagtattgttcgacagctctgcggagaaccttatctttcagtca
caatatctgaagcttcgtacctggctcccggagaacccatatttgtatggtctaggagag
cataccgaccccttacgcctttctactaccaactacacacgtaccttctggaatcgtgac
gcctatggtacttctgcaaatagcaatttgtatggcactcatcctgtgtactacgaccat
cgcggtgaatccggaactcacggtgttttcttgctgaactccaatggaatggacgttttc
attgacaagacggcagacggcaagcaataccttgagtataacgctctgggtggcattttt
gacttttacttcttcactggctcgaatccaaaagaggccagtatagagtattctaagatc
gtcggccttcctgctatgcagagttactggacttttggattgcatcaatgccgatacggc
taccgtgatgtctatcaggttgcggaagtagtctataactataccaaggctggcatcccc
ctagagactatgtggacagacatcgactacatggaccgaaggagagttttctctcttgac
ccagaccgcttccccttggaaaagatgcgtgagctggtcggttacctccatgaccacgac
cagcattacattgttatggttgaccctgctgttagtgtgagcgacaacggggcctttaac
aggggactcgagcaggacgtcttcctcaagactcaaaatggcagtttatacaaaggtgcc
gtgtggcctggtgtgactgcttatccagattggtttcaccctgacattcaagactactgg
aactctgaattcagtaccttcttcaacgcggagaccggtgtcgacattgacggcctgtgg
atcgacatgaacgaggcctcgaatttctgtccagatccctgtactgatccagaaagatat
tcctccgagaacaatcttccacctgcgccaccacccgtccggtcaagcagccctcgtccc
ttgcctggctttcctgctgatttccagccttcctctgccagccgatctcagaagagaatc
gtcaaggcaaaggtcggacttgagggccgcgatctactcaatccaccttacaagatccgg
aacgaggccgggtcccttagcaacaagaccatcaacactggtatcgttcacgctggagag
ggatatgcagaatatgatacgcacaatttatatggaacaatgatgagctccagttctcgt
gaagctatgcagtatcgtcgccctgaggtgaggcctctggttattacccgcagcacttac
gcgggtgcaggacgagacgttggacattggctcggtgacaatttcagcaagtgggaacat
taccggatcagcatcgctgaggggcttgcttttgcatcaatgttccaggtccctatggtt
ggggctgacgtctgtgggttcgctggtaacacgactgaggagctttgcgctcgctgggcc
tccttgggagcattctttactttctaccgcaaccataatgagatcggcaacattggacag
gaattctacgtctggcccacagtagcggaatccgctcgcaaggctattgacatccgatac
cggcttctcgattacatttacacctcgttctacaagcagtcgcagaccggcgagccattc
ttgcagccagtattctacttgtaccctgaagacgagaataccttctctatcgacttgcag
ttcttctacggtgacgccattctcgtcagcccagtccccgataagggccttacttcggtc
gatgcatacttccccgatgacatattctacgactggtacacaggcacacccgttcgtggc
catggcgcaaatatcactctcagcaacatcgacatcacccacattcccctacacatccgt
ggaggcagcattatccccatccggtcttcaagtgccatgaccacgactgagcttcgcgag
aagagcttccagctcatcatcgcgccgggactggacggcactgcgtctggcagcctgtac
ttggatgacggagactccttggagcaaaaggccacgctggaagtcgaattcgagtaccgc
aaaggtgtgcttcatattgacggaaagtttgagcttcacgccagcttggtagagtcggtt
actttactgggacagggcaagggtggatcccgggctcgccgtgaggatggtaccaagaag
accattcagacaaacctggagctttcgaagcccacggagatcaagttggaataa

DBGET integrated database retrieval system