KEGG   Aspergillus oryzae: AO090005001404Help
Entry
AO090005001404    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
aor  Aspergillus oryzae
Pathway
aor00020  Citrate cycle (TCA cycle)
aor00480  Glutathione metabolism
aor01100  Metabolic pathways
aor01110  Biosynthesis of secondary metabolites
aor01130  Biosynthesis of antibiotics
aor01200  Carbon metabolism
aor01210  2-Oxocarboxylic acid metabolism
aor01230  Biosynthesis of amino acids
aor04146  Peroxisome
Module
aor_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AO090005001404
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AO090005001404
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AO090005001404
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AO090005001404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 5990276
NCBI-ProteinID: XP_023089352
LinkDB All DBs
Position
1
AA seq 501 aa AA seqDB search
MMNSLRLHSASVRRAVASPLSAPLSSSAYRSISCSSSSYISSSSSSSFSTAATPRAQRPL
ASSQLPRIVSPRQTGIYPLQWTQARTMATEGPKIKVKNPVVELDGDEMTRIIWQEIREKL
TSESSYLDIDLKYYDLGLEYRDQTDDQVTVEAAEAIKKYGVGVKCATITPDEARVEEFKL
KKMWLSPNGTIRNILGGTVFREPIIIPRVPRLVPGWTKPIIIGRHAFGDQYRATDRVIPG
PGKLELVYTPVNGEPETVKVYDFQGGGVTQTQYNTDESIQGFAHASFQMALLKGLPLYMS
TKNTILKKYDGRFKDIFQEIYESTYKKDFEAKNIWYEHRLIDDMVAQMIKSEGGFVMALK
NYDGDVQSDIVAQGFGSLGLMTSTLTTPSGEAFESEAAHGTVTRHYREHQKGRETSTNPI
ASIFAWTRGLVQRGKLDETPDVVAFAEELERACIEVVNDEGIMTKDLALACGRKDRDAWV
TTKEYMAAVERRLKTNLKSRL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgatgaattcccttcggctccattccgcgtcggttcgccgcgctgtcgcctcccctctg
tctgcccctctctcttcctccgcttatcgctcgatctcctgctcttcttcttcttacatt
tcctcttcgtcttcttcttctttctcgactgctgctacccctcgcgctcagagacccctc
gcttcgtctcagctccctcgtattgtctccccccgccagaccggaatctaccctttgcag
tggacacaggcccgcaccatggcaactgaaggccccaagatcaaggttaagaacccagtg
gtggaactggatggagatgagatgacccgtattatctggcaggagatcagagagaagcta
acttccgagtccagttaccttgacattgacctcaagtactacgacctgggacttgaatac
cgtgaccagaccgatgaccaggtcaccgtcgaggccgcggaggccatcaagaaatatggt
gttggtgtcaagtgtgctaccatcacccccgatgaagcccgtgttgaggagttcaagttg
aagaagatgtggctttctcccaacggaaccatcagaaacattctcggcggaactgtcttc
cgtgaacccatcatcattccccgcgttccccgtctcgtacctgggtggaccaagcctatc
atcattggacgtcacgccttcggtgaccagtaccgtgccactgaccgtgtgattcccggc
cccggcaagcttgagcttgtctacacccctgtcaatggcgagcccgagaccgtcaaggtc
tacgacttccagggcggcggtgttactcagactcagtacaacactgatgagtccatccag
ggcttcgcccacgccagtttccagatggccttgctgaagggtctgcctctgtacatgagc
accaagaacaccattctgaagaagtacgatggtcgcttcaaggatatcttccaggagatc
tacgagtccacctacaagaaggatttcgaggccaagaacatttggtatgagcaccgtctg
atcgacgatatggtcgctcagatgatcaagagcgagggtggcttcgttatggctcttaag
aactacgatggtgatgttcagtcggacatcgtcgcccagggtttcggttctctgggtctg
atgacctctaccctcaccacccccagcggtgaggccttcgagtctgaagccgctcacggt
accgtgacccgtcactaccgtgagcaccagaagggccgtgagacctccaccaaccccatt
gcctccatctttgcctggacccgtggtctggtgcagcgtggcaagctcgacgagaccccc
gacgtggttgctttcgccgaggagttggagcgtgcctgtatcgaagtcgtgaacgacgag
ggcatcatgaccaaggacttggctctcgcctgcggccgcaaggaccgtgacgcgtgggtc
accaccaaggagtacatggcagctgttgagcggaggctgaagaccaacctgaagtccaga
ctgtaa

DBGET integrated database retrieval system