KEGG   Aspergillus oryzae: AO090010000746Help
Entry
AO090010000746    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; predicted protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
aor  Aspergillus oryzae
Pathway
aor00500  Starch and sucrose metabolism
aor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AO090010000746
Enzymes [BR:aor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AO090010000746
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 5999830
NCBI-ProteinID: XP_001827696
UniProt: P36914
LinkDB All DBs
Position
8
AA seq 612 aa AA seqDB search
MVSFSSCLRALALGSSVLAVQPVLRQATGLDTWLSTEANFSRQAILNNIGADGQSAQGAS
PGVVIASPSKSDPDYFYTWTRDSGLVMKTLVDLFRGGDADLLPIIEEFISSQARIQGISN
PSGALSSGGLGEPKFNVDETAFTGAWGRPQRDGPALRATAMISFGEWLVENGHTSIATDL
VWPVVRNDLSYVAQYWSQSGFDLWEEVQGTSFFTVAVSHRALVEGSSFAKTVGSSCPYCD
SQAPQVRCYLQSFWTGSYIQANFGGGRSGKDINTVLGSIHTFDPQATCDDATFQPCSARA
LANHKVVTDSFRSIYAINSGRAENQAVAVGRYPEDSYYNGNPWFLTTLAAAEQLYDALYQ
WDKIGSLAITDVSLPFFKALYSSAATGTYASSTTVYKDIVSAVKAYADGYVQIVQTYAAS
TGSMAEQYTKTDGSQTSARDLTWSYAALLTANNRRNAVVPAPWGETAATSIPSACSTTSA
SGTYSSVVITSWPTISGYPGAPDSPCQVPTTVSVTFAVKATTVYGESIKIVGSISQLGSW
NPSSATALNADSYTTDNPLWTGTINLPAGQSFEYKFIRVQNGAVTWESDPNRKYTVPSTC
GVKSAVQSDVWR
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctttctcctcttgtctccgggccttagccctcggatcctcagttctcgcggtc
caacctgtccttagacaggcgactggtctagatacctggctgagcacagaagcaaatttt
tcccgccaggcaatcttgaataatatcggcgcagatggccagtcggcgcagggcgcaagt
ccaggggtggtgattgccagccctagcaaaagtgacccagattatttctatacctggacc
cgtgactcgggtctcgtcatgaaaaccctggtcgatctgttcagaggcggagatgccgat
cttctccctatcatcgaggagttcattagctcccaggctcggatccaaggcatctcaaac
ccttctggtgctctttccagtgggggtctgggcgagcctaagttcaatgtcgacgagaca
gcatttaccggcgcatggggtcggccgcagcgtgacggaccagctttgcgcgcgaccgct
atgatctcgtttggagaatggctagttgaaaatggtcatacaagcatagcgacggacctg
gtatggcctgttgttaggaatgatctatcctatgtggctcagtattggagccaatccggg
ttcgatctctgggaggaagtccaaggcacatcattctttactgttgcagtttctcatcgc
gctttggtagaaggtagcagcttcgcaaagactgtcggttcctcgtgcccctattgtgac
tcgcaagcgccccaagtccgatgttatttacaatccttctggaccgggagttacatccag
gccaatttcggtggcgggcgatcgggcaaagacatcaacactgtcctgggtagtatccac
acgttcgatcctcaagcgacgtgtgatgatgctaccttccagccctgttcggcgcgagcc
ttggccaaccataaggtagtaacggactcgttccgatcaatctatgccatcaactccggt
cgtgctgagaatcaagctgttgctgttggccgctaccccgaagacagctattacaacggg
aatccttggttcctgaccaccctggccgccgcagagcagttgtatgacgcgttgtaccag
tgggataaaattggatcattggccatcacggacgtttctttgccattcttcaaagctctt
tacagttctgccgcgacagggacctacgcatcgtccacgacggtgtataaggatattgtc
tcagccgtcaaggcctatgcagacggatacgtgcagatcgtccaaacctacgctgcatcc
accggctccatggccgagcaatataccaagacggacgggagtcagacctccgcccgggat
cttacctggtcgtacgctgcacttctcacggccaacaaccgacgaaacgcggtcgttcct
gcaccatggggcgagaccgctgccaccagcattccgtcagcttgctctacgacttccgcc
tcgggcacctacagcagcgtggttatcacatcctggccgaccattagcggatacccaggc
gcgccagacagcccctgccaggtgccgacgactgtgtcggtgaccttcgcggtgaaagct
actacggtctacggtgagtctatcaagatcgtcgggtcgatctctcagctcgggagctgg
aatcctagcagcgcgaccgcattgaacgcggacagctacactactgacaaccccttgtgg
acgggaacaataaacttgcctgctggacagtcgttcgagtataagtttattcgcgttcag
aacggggcggttacgtgggagagtgaccccaaccggaaatataccgttccttcgacttgc
ggggtgaaaagtgctgtgcagagcgatgtttggcggtga

DBGET integrated database retrieval system