KEGG   Aspergillus oryzae: AO090020000415Help
Entry
AO090020000415    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; succinate dehydrogenase, flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
aor  Aspergillus oryzae
Pathway
aor00020  Citrate cycle (TCA cycle)
aor00190  Oxidative phosphorylation
aor01100  Metabolic pathways
aor01110  Biosynthesis of secondary metabolites
aor01130  Biosynthesis of antibiotics
aor01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AO090020000415
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AO090020000415
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AO090020000415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO PAPS_reduct HI0933_like
Motif
Other DBs
NCBI-GeneID: 5996823
NCBI-ProteinID: XP_001824737
UniProt: Q2U4B1
LinkDB All DBs
Position
6
AA seq 647 aa AA seqDB search
MSSLSLRSLAPASKISRALRDQRRLFSSTRPAARIFGSNPLRAREATGAIAEKYPIIDHE
YDAVVVGAGGAGLRAAFGLAEAGFNTACVSKLFPTRSHTVAAQGGINAALGNMHEDDWRW
HMYDTVKGSDWLGDQDAIHYMTREAPASVRELEGYGCPFSRTEDGRIYQRAFGGQSKEFG
KGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFALDLLMEDGECRGIIAYNQED
GTLHRFKAHHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIY
GAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPEK
DHIYLQLSHLPAELLHERLPGISETASIFAGVDVTKQPIPVLPTVHYNMGGIPTKYTGEV
LTQDENGADKVVPGLYACGEAACVSVHGANRLGANSLLDLVVFGRAVSHRVRDIATPGKP
HRELSSDAGAQSIKDLDFARTADGPKSTFEIRNAMQKAMQTDVSVFRTQESLDEGVAKVT
EIDQLYDQVGTKDRSMIWNSDLVETLELRNLLTCATQTAVAAANRKESRGAHAREDYPDR
DDENWMKHTLTWQKKPHGKIDLGYRAVEHNTLDEKECKPVPPFKRVY
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgagctccctgagcttgcggagcctagctcccgcatccaagatttcccgtgccttgagg
gatcagagacgtcttttttcctcaacccggcccgcagcccggatttttggcagcaaccca
ttgcgcgctagggaagccactggcgctatcgccgagaagtacccgatcattgaccacgag
tacgatgctgtcgtcgtcggtgctggaggtgctggtcttcgtgccgccttcggtctggcg
gaagccggttttaacactgcctgtgtctcgaagctcttccctacaagaagtcacactgtt
gctgcccagggtggtatcaacgctgctcttggaaacatgcacgaggatgactggagatgg
cacatgtacgataccgtgaagggttctgactggctcggagaccaggatgccattcactac
atgaccagagaagcccccgctagtgttcgtgagcttgagggctacggatgccccttctct
cgtaccgaggacggccgtatctaccagcgtgccttcggtggtcagtccaaggaattcgga
aagggcggccaggcctaccgttgctgtgctgccgctgatcgtactggtcacgctcttctt
cacactctctatggacagtccctgcgtcacaacactaactacttcatcgaatacttcgcc
cttgacctgctgatggaggatggtgagtgccgcggtatcattgcctacaaccaggaggat
ggtactctgcaccgtttcaaggcccaccacaccgtcctggccactggtggatacggacgt
gcctacttcagctgcacttctgcccacacttgcactggtgatggtatggccatggttgcc
cgtgctggtcttcccaaccaggatctcgaattcgttcagttccatcccacaggtatctac
ggtgctggatgtctgatcaccgagggttctcgtggtgagggtggttacctgctcaactcc
gagggtgagcgtttcatggagcgttacgctcctaccgccaaggatttggcttctcgtgat
gtcgtttctcgctctatgaccctggaaatccgcgagggccgtggtgttggtcctgagaag
gatcacatctaccttcagctgagccacttgcccgctgagctcttgcacgagcgtctgccc
ggtatctcggaaaccgcttccatcttcgctggtgtcgacgtgaccaagcaacccatcccc
gtcttgcccaccgtccactacaacatgggtggtatccctaccaagtacactggtgaagtc
ctgactcaggatgagaacggtgccgacaaggttgttcctggtctgtacgcttgcggtgaa
gccgcctgcgtgtccgtccacggtgccaaccgtcttggtgccaactctcttctggatttg
gtcgttttcggtcgcgctgtttctcaccgtgtccgtgacattgccacccctggcaagcct
caccgtgagctgagctccgacgctggtgctcagtccatcaaggatctcgacttcgctcgt
actgcggacggccccaagtccactttcgaaatccgtaacgctatgcagaaggccatgcag
actgacgtcagcgtcttccgtactcaggagagtttggatgagggtgtcgccaaggtcact
gagattgaccagttgtacgaccaggtcggtaccaaggaccgcagcatgatctggaactct
gacctcgtggaaactcttgaactccgcaaccttttgacctgcgccacccaaaccgctgtt
gccgccgctaaccgtaaggagtctcgtggtgctcacgcccgtgaggactaccccgaccgt
gatgacgagaactggatgaagcacactctcacgtggcagaagaagccccacggcaagatc
gacctgggctaccgtgccgtcgagcacaacaccctggatgagaaggagtgcaagccggtg
ccacccttcaagcgtgtctactaa

DBGET integrated database retrieval system