KEGG   Aspergillus oryzae: AO090023000149Help
Entry
AO090023000149    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aor  Aspergillus oryzae
Pathway
aor00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AO090023000149
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aor02000]
    AO090023000149
Enzymes [BR:aor01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AO090023000149
Transporters [BR:aor02000]
 Other Transporters
  Pores ion channels [TC:1]
   AO090023000149
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_C_3 GST_N_2 GST_C_2 Tom37
Motif
Other DBs
NCBI-GeneID: 5992730
NCBI-ProteinID: XP_001820728
UniProt: Q2UI89
LinkDB All DBs
Position
3
AA seq 223 aa AA seqDB search
MQPIILYSHPYGPNPWKVAIILEELNLPYETLFVSFQDVKKEPFIKLNPNGRLPAIEDPN
KNITLWESGAIVEYLVDNYDTENELSYTDFATKYETKAWLHFQVSGQGPYYGQAGWFNRA
HPERLPSVIERYGNEMRRVTGVLDSVLKNREWLVGDKCTYVDLCFMPWQRWVSKYATDAE
NVDRDFPHAAAWFKKLSERPSVKKVFADQDRAIEESIKNQTGL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccataatcctctactcccacccctacggtccaaacccctggaaggtagccatc
atcctggaagagctaaacctcccctacgaaaccctcttcgtcagcttccaagacgttaaa
aaagaacccttcatcaaactaaaccccaacggccgtctccccgccatcgaagaccccaac
aaaaacataacactctgggaatccggcgcgatcgtggaatacctcgtcgataactacgat
accgagaacgagctcagctacactgacttcgctaccaaatatgaaaccaaggcatggctg
catttccaagtttctggtcaaggcccgtactacggacaggctgggtggttcaaccgtgcc
catccggaacgtctgcccagtgttattgagcggtatgggaatgagatgcggcgtgtgact
ggggttttggattccgttttgaagaatagagagtggttggttggggataagtgcacttat
gttgatttatgtttcatgccctggcaacgatgggtgtcgaagtatgcgacggatgcggag
aacgtggatagggattttcctcatgctgcagcgtggttcaagaagttgagtgagaggcct
tctgttaagaaggtttttgcggatcaggatcgggcgattgaggagtcgatcaagaatcag
actggtttgtaa

DBGET integrated database retrieval system