KEGG   Aspergillus oryzae: AO090023000523Help
Entry
AO090023000523    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; threonine dehydrogenase and related Zn-dependent dehydrogenases
Organism
aor  Aspergillus oryzae
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N NAD_binding_7 FAD_binding_3 ADH_zinc_N_2 ADH_N_assoc Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 5993065
NCBI-ProteinID: XP_001821063
UniProt: Q2UHA4
LinkDB All DBs
Position
3
AA seq 353 aa AA seqDB search
MEAVRFHGPRDIQVETIDEPICGKGQVKIRPAFVGLCGSDIHEYTGGPVLIPQEPHNITG
RSYPVTLGHEFSGIVEEVGEGVTHVSPGQRVVVRPTIFDRQCTACKRGYEYCCENIGFIG
LSGYGGGLAKYHVAPAEHFYPIPDNVSLEAAALTEPLAVAWHAVNLSPFKMGDNVMVVGG
GPVGIGIVQVLKLQGAKNIMVSELYEKRRKFAIEYGATHTFDPDQEDVTQRVMEVTDSIG
ADVIFDAAGVEKALNGAISACRTHGTIVNVAVWEKKPAIPVNDLMYNEVNYTGSALYDEG
SFEAVIKALGYGQLKPEKMITSKIKLNETVEKGFETLVNDREDHCKILIDVQA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggaagcggtccgcttccatggaccccgcgacatccaggtggaaacaatagatgagcct
atttgtggcaaagggcaagtaaagatccgaccagctttcgtcggactctgtggcagtgac
atccatgagtataccggtggtcccgtattgataccccaagaaccccataatattactgga
cgttcatatccagttacacttggtcatgaattcagcggtatcgtcgaagaagtcggagaa
ggagtaacgcatgtgtctccaggacagcgggtcgtcgtacgtccgaccatctttgaccga
caatgcacggcatgcaaacgtggctacgaatactgctgcgagaatatagggtttattggg
ctttctgggtacggcggcgggttggcaaagtaccatgtcgcaccggcagaacacttctac
ccaatccctgacaacgtatctcttgaagcagcagccttgaccgagccactggcagttgcc
tggcacgctgtcaatctatcaccattcaagatgggcgataatgtcatggtggtagggggt
gggccagttgggattggcattgtgcaggtgttgaagttgcaaggcgccaagaatatcatg
gtatcagagctctatgagaagcgtaggaagtttgcgattgaatacggtgctacgcatacc
tttgatccggaccaggaggatgtgacgcagagggtcatggaagtgacggatagtataggc
gccgatgttatctttgatgctgctggtgtggaaaaggcattgaatggtgccatcagtgcg
tgtcgcacacatggtacaatcgttaatgttgcggtgtgggagaagaaaccagctattccc
gtgaacgacttgatgtacaacgaagttaattataccgggtcagcattgtacgacgaaggc
tccttcgaagctgttatcaaggcccttggatatggtcaattgaaaccagaaaagatgatt
acgtcgaagataaagttgaatgagacggtggaaaagggattcgaaaccctggtcaacgac
cgcgaggaccactgcaagatcctaatcgacgtgcaggcatga

DBGET integrated database retrieval system