KEGG   Aspergillus oryzae: AO090023000609Help
Entry
AO090023000609    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; predicted protein
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
aor  Aspergillus oryzae
Brite
KEGG Orthology (KO) [BR:aor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aor01002]
    AO090023000609
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aor04147]
    AO090023000609
Enzymes [BR:aor01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     AO090023000609
Peptidases [BR:aor01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   AO090023000609
Exosome [BR:aor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AO090023000609
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 5993139
NCBI-ProteinID: XP_023090681
LinkDB All DBs
Position
3
AA seq 229 aa AA seqDB search
MMKDTLSFARLALLLFGFVVIPTQAIVGGIATTNSISIGAVYTQGLFGSQYACAGTFVSS
NKFLTAADCVLGHSPRDISIKWGASNRLNEPSSSPPTLVTIHPDYNELTGDANVAVLTLK
TSTTGPSHATLAKESSIQTGDALTLYGWGLTGLEGLSTRFPAELHMVEVPALSTSECRSE
GIDIGAGQFCDQSDSGKGFCIGDHGGPVVDSSGTVVGIISGRENCGLAL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagatactctctctttcgcacgtctcgcacttttgctcttcggcttcgtcgtt
atacctacccaggctattgtggggggtattgctacaaccaactctatctctatcggtgca
gtttacacccaaggcctattcggcagtcaatatgcctgcgctggaacctttgtctcttcg
aacaaatttctcacggccgcagattgtgttttgggccattctccaagagacataagcatt
aaatggggtgcttcaaaccgcctcaacgaaccatcttcaagtcctccaacgttggtcacg
atccaccctgactataacgagttgaccggggacgcaaatgtggcagttcttactctaaaa
acatctacaacagggccctcccacgcgacactggccaaggagtcttctatccaaactggg
gatgctttgacgttatacggttggggccttaccggccttgaaggcctctccactagattc
ccggcagaattgcacatggttgaagtgccggctttgtcaacatccgaatgccgttcagaa
ggaattgatataggtgccgggcaattttgcgatcagtcagattctggcaaaggattttgt
atcggcgatcatggcggaccggtggtggattcatctggaacggttgttggtattatatcc
ggccgggaaaattgtgggcttgccctctga

DBGET integrated database retrieval system