KEGG   Aspergillus oryzae: AO090023000682Help
Entry
AO090023000682    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
aor  Aspergillus oryzae
Pathway
aor00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aor01100  Metabolic pathways
aor01110  Biosynthesis of secondary metabolites
aor01130  Biosynthesis of antibiotics
aor01230  Biosynthesis of amino acids
Module
aor_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AO090023000682
Enzymes [BR:aor01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     AO090023000682
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-GeneID: 5993202
NCBI-ProteinID: XP_023090711
LinkDB All DBs
Position
3
AA seq 481 aa AA seqDB search
MESDMPSWILTADSPLAWASKPIKQDVPYSDTKGVQAALDKLQKLPPLVTTQEITNLKKN
LENVALGKAFVLQGGDCAELFDYCNQDMIEAKVKLLLQMSLVLIWGANKPVVRIARIAGQ
FAKPRSSPMEVVNGVEMPSFRGDNINGFEATLESRTPDPSRLVSAYFHSAATLNYMRASL
TSGLADLHSPLDWGLGHVITPTIKEKYERIVNRVKDALRFMQTVGIDTDRGVETVDIYTS
HEGLLLEYEQSLTRLLKNPATETTHPAQAPGATTAPAPPQSYFATSAHFLWIGDRTRQLD
GAHIEFFRGIANPIGIKIGPSMTPDELVRILDVVNPTREIGKVTLISRYGAQKIAQHLPG
HIAAVQASGHLPVWQCDPMHGNTQSTPSGVKTRHFTDILSELRQALEIHKAAGSFLGGMH
LELTGEAVTECVGGAGGLTEENLSERYTTFCDPRLNEKQALELAFLVAGFYREMDEETNS
I
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgacatgccgtcctggatactgacagcggactccccactagcctgggcttcg
aaacccatcaaacaggatgtcccttacagtgacaccaaaggtgttcaagcggctttggac
aagttacagaaattgcctcctttggtcaccacacaagagatcaccaacttgaagaagaac
ttggaaaatgtagcactaggaaaggccttcgtactccaaggaggagattgtgcggagctg
tttgactactgtaatcaagacatgatcgaggctaaagttaagctgcttttgcaaatgagc
ttagtcctgatttggggtgccaataagccagtcgtccgtattgcgcggatagcagggcag
tttgccaagccgcggtcgagtcccatggaagttgttaatggtgttgagatgccctcattc
cgtggagacaatatcaatggatttgaggccaccctggaatcccgcactccagacccatcg
cggctggtctctgcatacttccattctgccgccacgctcaactacatgcgcgcatcatta
acctctggtctggctgatctccactccccactggactggggactcggtcatgtcatcaca
ccgaccatcaaggagaaatacgagcgcatcgtcaacagggtcaaggacgccctgcggttc
atgcagaccgtggggatcgacactgaccgtggtgtagaaaccgtcgatatctacacaagt
cacgagggtcttctacttgaatacgagcagagtctaacccgccttcttaaaaatccagcc
actgagactacccaccctgcacaagccccgggggcaacaacagcccctgcacccccgcaa
agctactttgctacatccgcccacttcctctggatcggagatcgcacccgtcaactcgac
ggcgcacatatcgagttcttccgcggcatcgctaaccctatcggcatcaagattggcccc
agcatgaccccggacgagctcgtgcgcatccttgacgtcgtgaaccccactcgcgagatc
ggcaaagttacacttatctcccgctatggtgcacagaagatcgcccagcatcttcccggc
cacatcgccgccgttcaggcctccggccacctgcccgtctggcaatgcgatcccatgcac
ggcaacacccagtccacgccctccggcgtcaagactcgtcatttcaccgacattctctct
gagctgcgtcaagctttggaaatccacaaggcggctggctcgttccttggcggcatgcat
cttgagctgaccggcgaggcagtcacggagtgcgttggtggtgccggcggtttgaccgag
gagaacttgagtgagcggtacacgacgttctgtgacccccggttgaacgagaagcaggca
ttggagttggcgttcttagtggctggattttaccgcgagatggacgaagagacgaattcg
atctaa

DBGET integrated database retrieval system