KEGG   Aspergillus oryzae: AO090026000028
Entry
AO090026000028    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; choline dehydrogenase and related flavoproteins
  KO
K17646  5'-oxoaverantin cyclase / versicolorin B synthase [EC:4.2.1.142 4.2.1.143]
Organism
aor  Aspergillus oryzae
Pathway
aor00254  Aflatoxin biosynthesis
aor01100  Metabolic pathways
aor01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    AO090026000028
Enzymes [BR:aor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.142  5'-oxoaverantin cyclase
     AO090026000028
    4.2.1.143  versicolorin B synthase
     AO090026000028
SSDB
Motif
Pfam: GMC_oxred_N GMC_oxred_C Pyr_redox_3 DAO FAD_binding_2 Pyr_redox_2 NAD_binding_8 Thi4 Lycopene_cycl NAD_binding_9 Trp_halogenase FAD_binding_3 HI0933_like TrkA_N Nucleoporin_FG2
Other DBs
NCBI-GeneID: 5993558
NCBI-ProteinID: XP_001821530
UniProt: Q2UFY7
LinkDB
Position
3
AA seq 643 aa
MGRNWFQVTAMAVVPVVGIMAAVNPTILSSAASSLPSLGAMFTSDDFASQMDGRIQAQGL
LSSHFGMYGWPGQSFDYVIVGGGTAGLAMARRLSQDGTASVAVIEAGGFYETDAGNATEV
PMYLFNYFFDNGKVKNPLFDWYQYTTPQPGLAQREMFYMQGKTLGGSTARGAMLYHRGSK
GAYDMWADHVGDDSYRWDKWLPYFQKSVHFSGPETNPRPANATALNDNTAFTASGGPVHV
GYPFQVNAISSWVDKALAKMGFPEAQGFSNGNLLGRSYITHTINPYTRRRETASSSYLRE
ALMESNNLNIFTRTLVKRVLFDDQNRATGVTVSTDGFEWQIGAKKEVILSAGVMRSPQLL
MVSGIGPKEHLDQLGIPVRSDLSGVGQNMQDTIILGPTVPVKVESHSQLMGNKETLPRAI
REYNEQRKGLLTNPGQDYFAFEKHQPGMLKESTAADIDAAFPDDWPTFSYIALDDTFVPQ
YDGKNYFSMSAALMTPFSRGTVTINSNDTANPPIVDPQWLADPRDQEMAVAAFRRCREIV
ASDVMREVVAGPEILPGPQYQTDEEILNYIAETSDAYYAGVGTCAMGKADDSKAVVDSKA
RVLGVKGLRVVDASIFPFAIDGQPMGTVYALAEKIAAEMMAEQ
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgggacgaaactggttccaggtaacagccatggcggtggtccccgtggtgggcatcatg
gccgctgtcaatccgactatcttgtcctccgcagcttcctccctcccatcgctaggggca
atgttcacatcggacgattttgctagccaaatggacgggcgcattcaggcacagggactg
ctcagctcgcactttggcatgtacggatggccgggacagtcgttcgactacgtgattgtc
ggcggtggaacagcaggcctggctatggcccgtcgcctgtcccaggatggaactgcttca
gttgccgtgattgaggcgggaggattttatgaaaccgatgctggcaatgccaccgaggtt
ccgatgtatctgttcaactacttcttcgacaatggcaaggtcaaaaaccctctatttgac
tggtatcaatacaccacgccgcaacccgggctggcacagcgcgaaatgttttatatgcag
ggaaagaccttgggcggaagcactgcacgaggggccatgttgtaccacagaggctcgaaa
ggcgcatacgatatgtgggcagatcacgttggcgacgatagttacagatgggataaatgg
ctgccctatttccagaagagcgttcatttctctggtccagaaacgaaccctcgtcctgcg
aatgctacggctctcaacgacaacacggccttcacggcttcgggaggccccgtacacgtc
ggctatccgttccaggttaatgccatctcgtcctgggtggacaaggctctggccaaaatg
ggctttcctgaagctcagggcttctccaatggcaacctgttgggccgttcatacataact
cacaccatcaacccctacacccgtcgccgcgagaccgcttcgtcttcctatctccgcgag
gcgctgatggaaagtaataacctcaacatctttacacgcactctggttaaacgggtcctt
ttcgacgatcagaatcgagcgacaggagtaaccgtaagcaccgacggcttcgagtggcag
atcggagccaagaaggaggtcattctgagcgccggcgtcatgcgttcaccccagctgcta
atggtgtctggaatcgggcccaaagagcatttggatcagctgggcattccagtacgatct
gatctcagcggagtgggccaaaacatgcaggacaccattatcctggggcctacagttcca
gtcaaggtcgagagccacagtcagttgatgggtaacaaagagacactgccccgggctatt
cgcgagtacaacgagcagcgtaagggtctgttgaccaatccaggccaggattattttgcg
tttgagaaacaccagccaggcatgctgaaggagtctaccgccgccgatatcgacgccgca
tttcccgatgactggccgaccttttcatatattgcactggacgacaccttcgttccacaa
tatgacggcaagaattattttagcatgtctgccgctctgatgactcccttcagtcgtggt
acggtcacgatcaacagcaatgatacagccaacccgcccatcgtggacccacaatggttg
gccgatccaagagaccaggagatggcggttgctgctttccgtcgttgtcgcgagattgtt
gcatcggacgtgatgcgagaggtcgttgctggacccgagattttgcccgggccgcagtat
cagacggatgaagaaatactaaactatatcgccgagacatcagatgcttattatgccggg
gtaggcacctgcgctatgggcaaagcagatgattccaaggctgtagtagattccaaggcc
agagtcttgggcgttaagggcctacgcgtggttgatgcttcaatctttccgtttgcgatt
gatggacagcccatgggcactgtgtatgctctggctgaaaagattgcagctgaaatgatg
gctgagcagtag

DBGET integrated database retrieval system