KEGG   Aspergillus oryzae: AO090026000426Help
Entry
AO090026000426    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; cAMP-dependent protein kinase catalytic subunit (PKA)
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
aor  Aspergillus oryzae
Pathway
aor04113  Meiosis - yeast
aor04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:aor00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AO090026000426
  09143 Cell growth and death
   04113 Meiosis - yeast
    AO090026000426
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aor01001]
    AO090026000426
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:aor03019]
    AO090026000426
   03036 Chromosome and associated proteins [BR:aor03036]
    AO090026000426
Enzymes [BR:aor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     AO090026000426
Protein kinases [BR:aor01001]
 Serine/threonine kinases: AGC group
  PKA family
   AO090026000426
Messenger RNA biogenesis [BR:aor03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     AO090026000426
Chromosome and associated proteins [BR:aor03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    AO090026000426
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 5993909
NCBI-ProteinID: XP_001821881
UniProt: Q2UEY6
LinkDB All DBs
Position
3
AA seq 464 aa AA seqDB search
MPSLGGLLKKRRTKDSQTLSKELEAGSSPTAAQTQTSPNQHHHSHQSHPTPTATSPDVAY
TSAQPHQSSHDHHNCSSGTNQSHPEGQPSSMQSAVTQSPPAHHHHGHHHTNSHNVASIQN
IIHSSHQSGQSVGGGSQQSQTRTTKGKYSLEDFSLQRTLGTGSFGRVHLVQSKHNHRFYA
VKVLKKAQVVKMKQIEHTNDERRMLNRVRHPFLITLWGTWQDSRNLYMVMDFVEGGELFS
LLRKSQRFPNPVAKFYAAEVTLALEYLHSHQIIYRDLKPENLLLDRHGHLKITDFGFAKE
VPDITWTLCGTPDYLAPEVVSSKGYNKSVDWWSLGILIFEMLCGFTPFWDSGSPVKIYEN
ILRGRVKYPPYLHPDAVDLLSQLITADLTKRLGNLHGGPEDVKNHPWFAEVTWDRLARKD
IDAPYVPPIRGGQGDASQYDRYPEEQEAYGQSGEDIHGHLFPDF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcttaggaggcttattgaagaaacggcggaccaaggattcgcagaccctcagc
aaagagcttgaagccggttcgtcacccacagcggcccagacgcagacgtcaccaaaccag
catcaccacagccaccaatcccatcccactcctactgccacctccccggacgttgcttat
acctctgcgcaacctcaccaatcgtcccacgatcatcacaattgctcttcaggcactaat
caaagccaccccgagggtcaaccatcctccatgcaatccgccgtgacgcaatctcccccg
gcccaccatcaccatggtcaccaccacaccaactcccataatgtcgccagtatacagaac
ataattcattcatcccatcagagcggccagtcggtcggcggaggttctcaacaatcgcag
acccgaaccaccaagggcaagtactctctcgaggatttcagcctccagcgcacattgggc
accggtagctttggtcgagtccatctcgtgcagtccaagcacaaccaccgcttctatgcc
gtcaaagttctgaagaaggcccaggtggtcaagatgaagcagattgagcatactaatgac
gagcgacgaatgctcaatcgcgtcaggcatccgttcttgatcaccctatggggcacatgg
caggattcgcgaaatctgtacatggtcatggattttgttgagggaggtgaactcttcagt
ctgcttcgcaagtctcagcgattccctaaccccgtggccaagttctacgccgcggaagtc
actcttgcgctggagtatctgcactctcatcagattatctatcgagatctgaagccggag
aacttacttctcgaccggcatggccacctgaagatcaccgactttggttttgcgaaggag
gtgcccgatatcacctggaccctgtgtggcacgcccgattatttggctcccgaggttgtt
tcatccaagggttacaacaagtcggtggactggtggtcccttggaatcctgatcttcgaa
atgctgtgtggcttcacacccttctgggacagcggatcgccggtcaagatctatgagaac
atcctccggggtcgggtaaaatacccaccttacctgcacccagatgctgtggatctactt
tcccaactgatcacagcagacctaaccaagcgcctgggcaacttgcatggtggtccggaa
gacgtcaagaatcatccgtggttcgccgaagtcacctgggaccggctggccaggaaagac
atcgatgctccctatgtaccaccgattcggggaggacaaggcgatgcaagccagtatgac
cgctacccggaagaacaggaagcctacggtcaaagtggcgaggacattcacggccatttg
ttccccgacttctaa

DBGET integrated database retrieval system