KEGG   Aspergillus oryzae: AO090038000300Help
Entry
AO090038000300    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; proteins containing SET domain
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
aor  Aspergillus oryzae
Pathway
aor00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    AO090038000300
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aor03036]
    AO090038000300
Enzymes [BR:aor01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AO090038000300
Chromosome and associated proteins [BR:aor03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     AO090038000300
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    AO090038000300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Metallothio_PEC
Motif
Other DBs
NCBI-GeneID: 5997335
NCBI-ProteinID: XP_023093082
LinkDB All DBs
Position
6
AA seq 435 aa AA seqDB search
MILFSTSRESLLRPQWNPLRLQNNLPNGSTIATTKLQSSTPSPSPVIKEQSLPARAISVV
VPSPSSQLKKEIESAKWASSSQSCTPELKGVLEKFYPTNAHVERGRKGAYPAARKVNRAA
IPLPTGTPGPILQKRPEALDQQYRTLERKLSTIKGPKITFAPADGPKLAKVTANFQFINS
YKLHKGVSPAPAEFIGGCSCGKHCDPERCPCSEKEDDSTENIIPYQRAKDRPDLLVLTPE
FLRRTAMIFECGAQCACDKSCWNRVVQRGRTVELEIFYTGNRGFGLRSPRYIREGQFIDC
YLGEVITKQHADIREETAVKNGHSYLFGLDFSPEVDEEDIYVVDGQRFGCATRFMNHSCK
PNCRMFTVTNTIGDERLYNLAFFALKDIPPMTELTFDYNPGTERSEKVDSSVVACLCGED
NCRGQLWPSKRKGTK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgattcttttttcaacttcaagagaaagccttctgcgccctcagtggaatcctctgcgg
cttcaaaacaatctgccgaatggcagtaccatagctactacaaagctccaatctagcacc
cctagcccgagtccggtcattaaggagcagagtctgccggcacgggccatcagtgttgta
gtcccttctccatcgtcacagctgaagaaggaaattgagtctgccaagtgggcatcaagc
tctcaaagttgtacccctgagctgaagggagtcctggagaaattctatccaactaacgca
catgtagagcgcggtcgcaagggtgcttatccagcagcgaggaaagtcaaccgtgctgca
atccctctgcctactggcacacccgggcccatcttacagaagagaccagaggcccttgac
cagcaataccgtactctggaacgcaagctttctacgatcaagggacctaagatcacgttt
gcgccagctgatggaccaaagctcgcaaaggtgaccgctaattttcagttcattaatagc
tataaacttcacaaaggggtttcccctgctccagctgaattcattggaggctgcagctgt
ggtaaacactgtgatcctgagaggtgcccctgctctgaaaaggaggatgattcaactgag
aacatcattccgtaccaaagagctaaggaccgcccagacctgctagtcctgactccagaa
ttcctgaggcgcaccgcaatgattttcgaatgtggtgcgcagtgtgcctgcgataagagc
tgttggaatcgggttgttcagcgtggcaggactgtggaattggaaattttctatactggc
aatcgtggctttggcctccggtctcctagatacatcagagagggccaatttatcgactgc
tacctaggagaagttattaccaaacaacacgcagatattcgcgaagagactgccgtgaaa
aatggccattcctatctctttggactcgacttctctcccgaagttgatgaagaagacatc
tacgtcgtcgatggacagaggttcggctgtgcaactcgtttcatgaaccactcctgcaaa
ccaaactgccggatgttcaccgtcacaaacaccatcggagacgagcgtctctataacctg
gctttcttcgccttgaaagatatcccaccgatgaccgaattgacgtttgattacaaccct
ggcacagagagaagcgaaaaagtcgactctagtgtcgtcgcttgcctgtgtggagaggat
aactgtcgaggtcaactctggccgagcaaacgcaagggcaccaaataa

DBGET integrated database retrieval system