KEGG   Aspergillus oryzae: AO090102000361Help
Entry
AO090102000361    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; glycogen synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
aor  Aspergillus oryzae
Pathway
aor00500  Starch and sucrose metabolism
aor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AO090102000361
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aor01003]
    AO090102000361
Enzymes [BR:aor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     AO090102000361
Glycosyltransferases [BR:aor01003]
 Polysaccharide
  Storage polysaccharide
   AO090102000361
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_trans_1_4 Glycos_transf_1 Glyco_transf_5 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 5994600
NCBI-ProteinID: XP_001822555
UniProt: Q2UAJ3
LinkDB All DBs
Position
4
AA seq 714 aa AA seqDB search
MASEETGAEPPKRDVRNHMLFEVATEVANRVGGIYSVLKSKAPVTTAEYGERYTLIGPLN
RASAAVEVEELTPSNPRMIETIKSMQERGIEVIYGRWLIEGAPRVLLIDTSTGYKFLDEW
KGDLWNTAGIPSPAADTETNEAIVFGYLVAWFLGEFIAHERRVAVVAHFHEWLAGVALPL
TKKRHMDLTTIFTTHATLLGRYLCAGSVDFYNHLQHFDVDAEAGKRGIYHRYCIERAAAH
TADVFTTVSHITAFESEHLLKRKPDGVLPNGLNVKKFSAVHEFQNLHSQSKEKINDFVRG
HFYGHNDFDLDNTLYLFTAGRYEFRNKGVDMFIESLARLNHRLKASGSKTTVVAFIIMPA
QTTSLTVEALKGQAVVKSLRDTIEMIEKGIGKRMYERCLAWKEGDNMPDEKDLMASQDRV
LLRRRLFAMKRHSLPPIVTHNMNNDHEDPILNQIRRVQLFNDPTDRVKIIFHPEFLNSSN
PVLPLDYDDFVRGTHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSS
DYGIYIVDRRMKGVDDSVNQLTDFMFNFALKSRRQRINQRNRTERLSDLLDWKRMGLEYV
KARQLALRRAYPSSFGSGEDFYDIIGGTEQKISRPLSVPGSPRDRSGMMTPGDFASLQEV
KEGLSTEDYIAWRLPGATDEDEPDDQYFPLTLRTKKTSDRPASPLDRISVNGGN
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgaggagactggcgccgaacctcccaagcgggatgttcgcaaccatatgctt
ttcgaagttgcgaccgaggtggctaatagggtgggtggaatttactccgtcctcaagtct
aaagctcccgtgacgaccgccgaatatggcgagcgatacactctgattggacccttgaac
cgtgcttcagcagcggtggaggtggaagaattgactccatctaatcctcgaatgatcgag
acgatcaagtcgatgcaagaacgtggcattgaggtcatctacggtcgctggctgattgaa
ggcgctccccgggtgcttttgatcgacacatcaacgggatataaattcctggacgagtgg
aaaggggacctgtggaacacggcggggatcccatcaccggctgcagacaccgaaaccaat
gaagcgattgtctttggatacctggtagcatggttcctgggtgaattcatcgcccatgaa
agacgggttgcggtggtcgcccatttccacgagtggcttgctggggtagccctcccgctg
accaagaagcgacatatggatctcaccacaatttttaccacccacgcaactttactcggt
cgctatctctgtgcgggatcagtggacttttataaccacctacagcacttcgatgtggat
gcagaggctggtaagcgtggcatctatcaccggtactgtattgagcgagccgcggcgcac
acggcagacgtcttcactaccgtctcccatatcaccgcgttcgaaagcgagcatctcctg
aaacgaaagccagatggagttctgccgaatgggctcaatgtcaagaagttctccgcagtg
catgagttccagaatctacactcacaatccaaagagaaaattaatgacttcgttcggggc
catttctatggccataacgatttcgatctggacaataccctgtaccttttcacggcggga
cgctatgaattccggaacaagggcgtcgatatgttcatcgaaagcttggctcgcctgaac
catcgcttaaaagccagcggctccaaaactaccgtagttgctttcatcatcatgccagcc
cagaccacgtctctcacggtcgaagccctcaagggacaggctgtcgtcaagtccttacgg
gacacaatcgagatgatcgaaaagggcattggaaagcgaatgtacgagcgttgccttgcg
tggaaggaaggcgacaacatgccggatgagaaggacctcatggccagtcaagatcgcgtg
ctgttgcgacgcaggttgtttgccatgaagaggcactctttaccgccgatcgtcactcat
aacatgaacaatgaccacgaagacccaattttgaaccagatccgccgtgttcagctgttc
aacgatccaaccgaccgcgttaagataatctttcacccagagttcctcaactcgtcgaac
cccgtgctaccactcgattacgatgactttgtccgcggtacgcatcttggagtcttccca
tcatactacgagccttggggttacacacccgctgagtgcactgtgatgggtgtccccagt
atcaccaccaatctgtccggtttcggttgctatatggaggagttaatcgagaactcatcc
gactacggtatttatatagtggatcgccgaatgaagggtgttgacgattccgtcaaccag
cttactgatttcatgttcaactttgctctgaagagccgccgccaacggatcaatcaacgt
aaccgcactgagcggttgagcgatctgttggactggaaacgtatgggattagagtatgtc
aaagcgcggcagctggctcttcggcgagcctacccgtcttcctttggtagcggcgaagac
ttctatgatattattggaggaacagaacagaagatttcacgaccgttatctgtcccaggg
tcaccaagggatcgctcggggatgatgacccctggtgattttgcatccctgcaagaagtc
aaagaaggactgagtactgaggactatatcgcatggcggctgcctggtgcaaccgatgag
gatgaaccagacgaccaatacttcccactgacactacgaacgaaaaagacatccgatcga
cccgcatcgccgctcgaccgcatatcagtcaatggtgggaactga

DBGET integrated database retrieval system