KEGG   Aspergillus oryzae: AO090102000466
Entry
AO090102000466    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; predicted protein
  KO
K23647  ditryptophenaline biosynthesis N-methyltransferase [EC:2.1.1.-]
Organism
aor  Aspergillus oryzae
Pathway
aor00998  Biosynthesis of various secondary metabolites - part 2
aor01100  Metabolic pathways
aor01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    AO090102000466
Enzymes [BR:aor01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     AO090102000466
SSDB
Motif
Pfam: Methyltransf_33 Methyltransf_11 p450
Other DBs
NCBI-GeneID: 5994681
NCBI-ProteinID: XP_023091833
LinkDB
Position
4
AA seq 407 aa
MKAPEYLAPLREELAAALKQTDNAWSFDIFKHTPKLESFTKECLRVFTPSGIIEIMREKR
SEDLETQIIQGLQFDSLQLPQDLLWDDAGQILFDDLCNSSVYYLTRKEKEILHKYSSDMV
ATIPEGSALIELGCGSLRKSGIILSALEKSKKAVTYYALDVSQESLQNGLAHLHKGLGPL
DHVELRGLWGTYEDGIAWVADQGPMNAYTSITFLWMGNSMTNMHLAQTQSLLSRMSDTCA
SSGIRCQFLVSADGCTAEDTVMAAYSTESQPFRDFMLNGLQSANRILGQDVFCSSNWTFG
TVFDRTRHEVQMFYTPTHDVSIYINSERRKISKGEKVAVVTSGKWPEPYFRSIVEGIGLQ
VLDLWTDSDQVYSSFRQRISQKEQRWWDLSSNEYGHVFPDIESICLC
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgaaggctcctgagtatttagctcctctgagagaagaactcgcggctgccctaaaacaa
accgataatgcatggagctttgacattttcaagcacacccctaagcttgagagctttact
aaggagtgtctccgtgtttttacgccttcaggaatcatcgagatcatgagagagaagcga
tcggaggatctagaaacgcagatcattcaaggtcttcaatttgacagtcttcaactgcct
caggacttgttgtgggacgatgctgggcagatactatttgacgatttatgcaattcctcg
gtctactaccttacaaggaaggagaaagaaatcctgcataaatattcgtctgacatggtt
gccacaataccagagggaagtgcgctcattgagctgggttgtgggagcttgcggaaatcc
ggaattatattgtccgctttggaaaaaagcaagaaggcagtaacgtactacgccctggat
gtgtcccaggagtctctgcagaatggtctagcccatctccataagggccttggccccctt
gatcatgttgagttgcgagggctctggggcacatacgaagacggcatagcgtgggttgca
gatcaaggccctatgaacgcgtacacaagtatcacctttctctggatgggaaacagcatg
accaatatgcatctcgcccaaacccagtcactgctctctcgcatgagtgatacatgtgct
agctcaggtatccgatgccagtttctggtatcggccgatgggtgcacagccgaggataca
gtgatggctgcttatagcacggagtctcaaccgtttagagactttatgttaaatgggctg
cagtccgcaaaccgcattctagggcaggatgttttctgctcttctaattggacatttggc
actgttttcgaccgtacgcgacacgaggtccaaatgttttacacccccactcatgatgtt
agcatctacatcaattcggaacggcgcaaaatcagcaagggagagaaagttgcagttgta
actagcgggaaatggcctgagccctacttccggtcaatagttgaaggcattggtctgcag
gtgcttgacctgtggacggacagcgaccaggtctactcatcttttcgacagaggataagt
cagaaagagcagaggtggtgggacttatcatcaaatgaatatggccatgtcttccctgac
atagagagtatctgcctctgctag

DBGET integrated database retrieval system