KEGG   Aspergillus oryzae: AO090103000342Help
Entry
AO090103000342    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; glutamate decarboxylase/sphingosine phosphate lyase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
aor  Aspergillus oryzae
Pathway
aor00250  Alanine, aspartate and glutamate metabolism
aor00410  beta-Alanine metabolism
aor00430  Taurine and hypotaurine metabolism
aor00650  Butanoate metabolism
aor01100  Metabolic pathways
aor01110  Biosynthesis of secondary metabolites
Module
aor_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AO090103000342
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AO090103000342
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AO090103000342
   00430 Taurine and hypotaurine metabolism
    AO090103000342
Enzymes [BR:aor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AO090103000342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 5999037
NCBI-ProteinID: XP_001826915
UniProt: Q2TY91
LinkDB All DBs
Position
8
AA seq 514 aa AA seqDB search
MVHLAQVHRNADLDSTIKRVDSIQLENTDEDGFYSSVYGTRFATEQLPQTEMPEREMPRE
VAYRMIKDELSLDGNPMLNLASFVTTYMEDEAEKLMTESFSKNFIDYEEYPQSAEIQNRC
VNMIARLFNAPVHSEDEHPMGTSTIGSSEAIMLGTLAMKRRWQNKRKAEGKDYSRPNIVM
NSAVQVCWEKAARYFDVEERYVYCTEDRYVIDPQQAVDLVDENTIGICAILGTTYTGEYE
DVKAINDLLIERNIDVPIHVDAASGGFVAPFINPKLEWDFRLPKVVSINVSGHKYGLVYP
GVGWVVWRSPEYLPKDLIFNINYLGAEQASFTLNFSKGASQVIGQYYQMIRLGKRGYRSI
MTNITVTADFLAQELEKMGFIIMSQRRGHGLPLVAFRLPAEREGQFDEFALAHQLRERGW
IVPAYTMAPNSNNLKLMRVVVREDFTKSRCDALLSDIKLGLKTLGDMDKAMLDKYTQHVR
THATHSHKSKHNHPHYKGETHSLQGKHGKTHGVC
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggtccacctcgctcaagtccaccgcaacgctgatctcgacagcaccatcaagcgtgtc
gactccattcaattggagaacactgacgaagatggattctactctagcgtctacggaaca
cggttcgcaacagaacagctgcctcagactgagatgccggagcgggagatgcccagagag
gtcgcctatcgcatgattaaggacgagttgagcctcgatggaaacccaatgctcaacttg
gcgagttttgtcacgacctatatggaagatgaagccgaaaagctcatgactgaatccttc
agcaagaacttcatcgattacgaggagtatcctcagtcagcggagatccagaaccgctgc
gtcaacatgattgcgcgtctgtttaacgcgccagttcacagcgaagacgagcacccgatg
ggcacctcgaccatcggatcgtccgaggcaatcatgctgggtaccctggctatgaagcgc
cgttggcaaaacaagcgcaaggctgaaggcaaggactactcccgccctaacatcgtcatg
aacagcgctgtacaggtgtgttgggaaaaggccgcacggtactttgacgtcgaggagcga
tatgtgtactgcaccgaggaccgctatgtgattgatccccagcaggcggttgacctggtt
gacgagaacactatcggtatctgcgctatcctcggaaccacctacaccggtgagtatgaa
gacgtcaaagcaatcaatgaccttctgatcgaacgcaacatcgatgttcccatccatgtt
gacgccgctagcggcggtttcgtcgctcctttcatcaaccctaagttggaatgggatttc
cgcctcccaaaggtcgtttcgatcaacgtgtctggccacaagtatggtctggtctaccct
ggcgtgggctgggtcgtctggcggtccccggaatatctccccaaggatctgattttcaac
atcaactacctaggagctgaacaggccagttttaccctgaacttctccaagggtgcatct
caggtcatcggccagtactaccagatgatccgacttggcaagcgtggctaccgctccatc
atgaccaacattactgttactgcggactttttggcccaagagctggagaagatgggcttt
atcatcatgagccagcgtcgcggccacggtctcccattggtcgctttcagactgcccgct
gagcgggagggtcagttcgacgagtttgccttggcacaccagctgcgtgagcgtggctgg
attgtccctgcatacacgatggcgcccaacagcaacaacctgaagctgatgcgtgtggtt
gtccgcgaggatttcacaaagagccggtgcgacgcgctgcttagtgatatcaagttgggc
ctgaagacgttgggtgacatggacaaggccatgttggataagtacacccagcacgtccgc
acccacgccacccactcgcacaagtccaagcacaaccaccctcactacaagggagagacg
cactccctgcagggtaagcatggcaagactcatggtgtttgctag

DBGET integrated database retrieval system