KEGG   Aspergillus oryzae: AO090120000322Help
Entry
AO090120000322    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; ATP-dependent DNA ligase IV
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
aor  Aspergillus oryzae
Pathway
aor03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:aor00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    AO090120000322
Enzymes [BR:aor01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AO090120000322
DNA repair and recombination proteins [BR:aor03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     AO090120000322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 RNA_ligase DNA_ligase_A_C LIG3_BRCT BRCT DNA_ligase_IV mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 5996306
NCBI-ProteinID: XP_023092498
LinkDB All DBs
Position
5
AA seq 1006 aa AA seqDB search
MDSDDDYNGPADTNPRLEDEESDLDEKYPNRPRNHSTTLPFHVLFQTLFYPLSEIKKKPA
GPARKKVGPHGLSSVNLTPLEKRRDIIDRFISRWRKEVGDDIYPAFRLILPDKDRDRAMY
GMKEKAIGKLLIRIMKIDKNSEDALNLLNWKLPGQTTTSSMAGDFAGRCFGVLSKRPMRT
EVGDMTIEEVNEKLDHLSAASKENQQLPILTEFYRRMNPEELMWLIRIILRQMKVGATER
TFFDVFHPDAENLYSISSSLRRVCWELHDPNIRLEAEDRGITLMQCFQPQLAQFQMHSLD
RMISRMRLTEDDPVFWIEEKLDGERMQLHMDSNDSVPGGRTFRFWSRKAKDYTYLYGNGI
QDENGALTRYLSDAFADGVESLILDGEMITWDTEQDAIAPFGTLKTAALSEQRNPYSSTT
RPLFRIFDILYLNGRDLTRYTLRDRRNALQKSIKPVYRRFEIHPYEEATGKTEIEEALRR
VVEEASEGLVLKNPRSPYRLNERHDDWMKVKPEYMTEFGESLDVVVIGGYYGSGHRGGGL
SSFLCGLRVDDAHSSQGMVASKCYSFCKVGGGFTAADYANIRHHTDGKWHEWKSRKPPTT
YIELAGGDAQYERPDMWIKPEDSVVLCVKAASVAVSDQFRIGLTLRFPRFKKLRMDKDWK
SALSVQEFLDLKANAERERKEKEFNVDNSRKKRAKRDNKKPLAIVGYSAEAEAQYTGPSG
NIFEGLNFYITTDSNTPVKKSKAELEQLVKANGGKFFQTSNAAPSTICIADRRTVKAASL
QKSGNVNIIRPSWILDCIRQSEIDAGLPDSLLPLEPRHVFFATQDKKEEIAASVDRFNDS
YARNTTNDELKEILKQMSKDHHFHASQNPKIVRKLNERIQEKVNAGWEMPSGWLFKGLTI
LFPQNDKVDDAEVDETSQTHQQYRLNLARNTVRFAGANVVDSKSSSVTHIVVAPGSSSSD
VSSIRKSHSAKPGKKVPHLVTAEWIEECWKQRTLLGEEGFQPSRGT
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atggattctgacgacgattacaatggccctgccgataccaatcctcgcttagaagatgag
gagtctgacctagatgaaaaatatcccaaccgcccacgaaatcattccactactttaccg
tttcatgttttgttccagacgcttttctatccattgagtgagatcaaaaagaagccagct
ggacctgcgcgcaagaaggtcggccctcatggactgtctagcgttaatctaactccattg
gaaaaacggcgagatattatcgaccgcttcatctcaagatggaggaaggaggtcggggac
gacatataccccgcttttcgattgattcttcccgacaaagatcgggatagggcaatgtac
ggaatgaaggagaaggctatcgggaagcttctaatccgaattatgaaaatcgataagaat
tcggaggatgctctcaatctcttaaactggaaattgcccggacaaacgactacgtctagt
atggctggtgatttcgcaggccgatgcttcggtgtactctcaaagcggccaatgcgcacg
gaagtgggtgatatgaccatcgaggaagtgaatgagaaactcgatcatttatccgcggcg
tctaaggaaaatcaacagttgccgatcttgacggaattctaccgacgaatgaacccagaa
gagctcatgtggcttatccgtatcatcctacgacagatgaaggttggagcgacggagcgc
accttctttgatgtgttccatccagacgcggagaatctgtacagcatttcgagtagtctt
cggcgcgtctgttgggaactgcacgatcctaatatccggcttgaggctgaagatagaggg
atcacgttgatgcaatgtttccaaccgcagctggctcaatttcagatgcactcactggat
cggatgattagccggatgaggctgacggaagatgatccggttttctggattgaggaaaaa
cttgatggggagcgtatgcagcttcatatggattcgaacgactcggtaccagggggtaga
acgtttcgcttctggtcaagaaaagccaaggactacacatatctctatgggaatggcatc
caagatgagaatggtgctttgacaagatacctcagcgatgcgtttgcagatggagtggag
agcttgattctggatggcgaaatgattacttgggatactgaacaggatgccattgccccc
tttggcacgcttaagacggccgcactatccgaacagagaaacccgtactcgagcactacc
cggcccttgttccgtatctttgacatactgtatttgaacggacgcgatctgacaaggtac
actcttcgtgaccgccgaaacgcattgcagaaaagtatcaaacctgtttatcgcaggttt
gaaatccacccttacgaagaagctacgggcaaaactgagatcgaggaagccctgcgaaga
gtcgtggaagaggcttccgagggcttggtacttaagaatcccaggtcaccctatcgcctg
aatgaaagacacgatgattggatgaaggttaagccggaatatatgactgagttcggagag
tcgttggatgtcgtcgtgattggagggtattatggatctggtcatcggggtggtggcctt
tcaagcttcttatgtgggttaagggtcgatgatgctcattcctcacaaggaatggtggca
tctaagtgttattcgttctgcaaggtaggaggaggctttactgcagctgattatgcaaac
atccggcaccacacggacggtaaatggcacgagtggaaatccaggaaacctcccacgaca
tacatagaactggcaggcggagatgcgcagtacgagcgcccagacatgtggataaaacca
gaagactcggtggttctctgcgttaaggcagcttcagtagctgtcagtgatcagtttcgt
atcggactgacgctacgctttccgcgcttcaaaaagctgcgtatggacaaagattggaaa
agcgctctctcagtacaagagttcctcgacttaaaagccaatgcggaacgagagcgtaaa
gagaaagaattcaatgtggataattcacgcaagaaacgggcgaagagggataacaagaag
cctttagctattgtcgggtacagtgcggaagcagaagctcagtacaccgggccatctggc
aatatcttcgaagggctaaatttctacattacaaccgactcaaacacaccggtcaaaaag
tcaaaggcggagttagaacagctcgtgaaggctaatgggggcaagttctttcagacgagt
aatgctgctccgagcacaatttgtatcgccgacagaaggactgtgaaagctgcgtccctt
caaaaaagcggcaatgtcaatattatccggccttcttggatccttgattgtattaggcag
agtgaaatagacgcgggtttgcctgattctcttcttcctctcgaacccagacatgtcttc
ttcgcgactcaggacaagaaggaggagattgcagcgagcgtcgatcggttcaatgatagt
tatgcccgcaacaccaccaatgacgaactgaaggagatcttaaagcagatgagcaaggat
catcactttcacgcttcgcagaatcccaaaatcgtccgaaaactcaacgagcgtatccag
gagaaagtcaatgccggatgggagatgccttccggctggctgttcaagggtctgaccatc
ctctttcctcagaatgacaaagtggatgatgcagaagtagacgagacgtcacaaacgcat
cagcaataccgtcttaatctagcacgcaacactgtacggtttgcgggagcgaatgttgtg
gattcgaaatcttcgtcggtaactcacatcgtcgtagctccgggcagctcatcttcagac
gtctcttcgatccgcaaatcgcactcagcgaaaccgggaaagaaggtgccacacctcgtc
actgccgaatggatagaggagtgctggaaacagcggacgctgttgggcgaagaggggttc
cagccgtccagaggtacctaa

DBGET integrated database retrieval system