KEGG   Amycolatopsis orientalis: SD37_07060
Entry
SD37_07060        CDS       T06703                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
aori  Amycolatopsis orientalis
Pathway
aori00250  Alanine, aspartate and glutamate metabolism
aori00410  beta-Alanine metabolism
aori00640  Propanoate metabolism
aori00650  Butanoate metabolism
aori01100  Metabolic pathways
aori01120  Microbial metabolism in diverse environments
Module
aori_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aori00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SD37_07060
   00650 Butanoate metabolism
    SD37_07060
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SD37_07060
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SD37_07060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aori01007]
    SD37_07060
Enzymes [BR:aori01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SD37_07060
Amino acid related enzymes [BR:aori01007]
 Aminotransferase (transaminase)
  Class III
   SD37_07060
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: ANN15440
UniProt: A0A193BTC7
LinkDB
Position
complement(1466715..1467965)
AA seq 416 aa
MAQLSPLLKQATPVVVDHGEGVYLYDTDGKRHLDFTAGIGVTSTGHCHPHVVSAAREQIG
KLIHGQYTTVMHKPMLELTEKLGGVLPKGLNSLFYANSGSEAVEAALRLSRQATKRPNVI
VFQGGFHGRTVAAATMTTSGTRFSAGISPLMSGVHVAPFPYAFHYGWDEETATKFALREL
DYLFATVCAPNETAAFFIEPVLGEGGYVPANTEFLAGLRERADKHGILLVMDEIQTGFGR
TGKFWGHDHFGVRPDIVLIAKGLASGFPISGIAASEELMAKALPGSQGGTYGGNAVACAA
AIATLEVIQREGLVENAAERGRQLLEGVRVIADKSPSIGDVRGLGLLVGSEFTTPDGEPD
TAKAQAAQKAASANGLLLLTCGAYMNVVRMVPPLVVNAEQVDDALRIWGDVVAGVE
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggcccagctatcaccgctgctcaagcaggcaacgccggtcgtggtcgaccacggtgaa
ggggtgtacctctacgacaccgatggcaaacgtcacctggatttcaccgccggtatcggc
gtgaccagcaccggccactgccacccgcatgtggtgagcgccgcgcgggaacagatcggc
aagctcatccacggccagtacacgacggtcatgcacaagccgatgctggagctgaccgag
aagctgggcggcgtcctgccgaagggcctgaattccctcttctacgcgaactcgggcagc
gaggctgtcgaggcggcgctccggctgtcgcgccaggcgacgaagcgtcccaacgtcatc
gtcttccagggcgggttccacggccggacggtcgcggcggcgaccatgaccacctcgggg
acccggttcagcgccgggatctcgccgctcatgtcgggcgtgcacgtcgcccccttcccc
tacgccttccactacggctgggacgaggagaccgcgacgaagttcgccctgcgggagctc
gactacctgttcgcgacggtctgcgcgccgaacgagacggccgcgtttttcatcgagccg
gtgctcggcgagggcgggtacgtcccggcgaacaccgagttcctggccggtcttcgggaa
cgcgccgacaagcacggcatcctgctggtgatggacgagatccagaccggcttcggccgg
acgggcaagttctggggtcacgaccacttcggggtgcgcccggacatcgtgctcatcgcg
aagggactcgcgagcgggttcccgatctcgggcatcgccgcgtcggaggagttgatggcg
aaggcgctccccggttcgcagggcgggacctacggcggcaacgcggtggcctgcgcggcg
gcgatcgccacgctcgaggtgatccagcgggaggggctggtcgagaacgccgccgaacgc
ggacggcagctgctcgaaggggtgcgcgtgatcgcggacaagtcgccgtcgatcggcgac
gtccgggggctggggctgctggtcggttccgaattcaccaccccggacggcgagccggac
accgcgaaggcccaggcggcgcagaaagccgcgtccgccaacgggctgctgctgctgacc
tgcggggcgtacatgaacgtcgtccggatggtcccgccactggtcgtcaacgccgagcag
gtggacgacgccctgcggatctggggcgacgtcgtggcgggggtcgagtga

DBGET integrated database retrieval system