KEGG   Actinomyces oris: AXE84_01625Help
Entry
AXE84_01625       CDS       T04280                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
aos  Actinomyces oris
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 2-Hacid_dh_C Glu_dehyd_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AMD98282
UniProt: A0A0X8K0H8
LinkDB All DBs
Position
complement(364772..365950)
Genome map
AA seq 392 aa AA seqDB search
MTSNEAVQASETTVSIPETIPETMKAAVLRDHEVGLQIETLRTPRPKSGEVLIKVAACGL
CHSDLHVIGGAIAFPLPAVLGHEVSGTIVELGPGNEHTGLTIGQKVAGGFLMPCGQCDAC
ASGRDELCGPFFDLNRLKGVLYDGTTRLATPDGEPVAMYSMGGLAEYAVVPSTAVAPVPD
TIDMVPAAILGCAAMTGYGAVRRGADLRYGETVAVVATGGVGTNIVQIARAFGASQVIAI
DVDDEKLAPMLDYGATAVVNSVTQDAREEVFRLTGGKGVDVSFEALGIPATWTTALDVLS
DGGRMVPIGLGAGVQTAGVEINRTVRRSQSILGSYGARTRQDLPAVVDLADKGVINYRDV
VSRRLPLEEAGAGYTALRNREIQGRAVVDMSL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcaacgaggcagtccaggcctcagagacaaccgtgtccattcccgagaccatt
cctgaaaccatgaaggctgcggtcctgcgggaccatgaggtcggcctgcagatcgagacc
ctgcgcaccccccgccccaagagcggtgaggtcctcatcaaggtggccgcctgcggattg
tgccactccgacctccacgtcatcggcggcgccatcgccttcccgctgccggcggtgctc
ggccacgaggtctccggcaccatcgtggagctcggccccggcaacgagcacaccggcctg
acgatcgggcagaaggtggccggcggcttcctcatgccctgcggccagtgcgacgcctgc
gcctcggggcgcgacgagctgtgcggccccttcttcgacctcaaccgcctcaagggcgtc
ctctacgacggcaccacccgcctggcgacccccgacggagagccggtggccatgtactcc
atgggtggcctggccgagtacgcggtcgttccctccaccgcggtggcccccgtgccggac
accatcgacatggtgccggccgccatcctgggctgcgccgccatgaccggttatggggcc
gtgcgccgcggcgccgacctgcgctacggggaaaccgtcgccgtggtcgccaccggcggc
gtgggcaccaatatcgtccagatcgcccgggccttcggcgccagccaggtcatcgccatc
gacgttgatgacgagaagctggcccccatgctcgactacggggctacggccgtggtcaac
tccgttacccaggacgcccgtgaggaggtcttccggcttaccggcggcaagggcgtcgat
gtctccttcgaggccctgggcatccccgccacctggaccaccgctctggatgtcctgtcc
gatggtggccgcatggtgccgatcggcctgggggccggcgtgcagaccgccggggtggag
atcaaccgcaccgtgcgccgctcgcagtcgatcctcggctcctacggggcgcgcacccgc
caggacctgccggctgtcgtcgacctggccgacaagggtgtcatcaactaccgcgatgtc
gtctcgcgccgcctaccgttggaggaggccggtgccggctacaccgcgctgcgcaaccgc
gagattcaggggcgcgccgttgtcgacatgtcgctgtga

DBGET integrated database retrieval system