KEGG   Actinomyces oris: AXE84_08455Help
Entry
AXE84_08455       CDS       T04280                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aos  Actinomyces oris
Pathway
aos00010  Glycolysis / Gluconeogenesis
aos00030  Pentose phosphate pathway
aos00051  Fructose and mannose metabolism
aos00052  Galactose metabolism
aos00680  Methane metabolism
aos01100  Metabolic pathways
aos01110  Biosynthesis of secondary metabolites
aos01120  Microbial metabolism in diverse environments
aos01130  Biosynthesis of antibiotics
aos01200  Carbon metabolism
aos01230  Biosynthesis of amino acids
aos03018  RNA degradation
Module
aos_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXE84_08455
   00030 Pentose phosphate pathway
    AXE84_08455
   00051 Fructose and mannose metabolism
    AXE84_08455
   00052 Galactose metabolism
    AXE84_08455
  09102 Energy metabolism
   00680 Methane metabolism
    AXE84_08455
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    AXE84_08455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:aos01009]
    AXE84_08455
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:aos03019]
    AXE84_08455
Enzymes [BR:aos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AXE84_08455
Protein phosphatases and associated proteins [BR:aos01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AXE84_08455
Messenger RNA biogenesis [BR:aos03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AXE84_08455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Proteasome DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AME00268
UniProt: A0A0X8K498
LinkDB All DBs
Position
complement(2098925..2101231)
Genome map
AA seq 768 aa AA seqDB search
MLGLDGEPLRIGVLTSGGDAQGMNAAVRAVVRTAIRLGARPYAVMEGWAGAVAGGDGIRP
LEWDSVGSILQRGGTIIGTARSAEFRERAGQLAAARNLLEHGIDRLVVIGGDGSLTGTNE
FRKNWPSLLEELVETGDISAQTAASHPVLMVTGLVGSIDNDLVGADMTIGTDSALHRILE
AIDDISSTAASHQRTFVVEVMGRHCGYLALMAAVAGGCDYVLVPELPPGKDWEEDMCSKL
KAGREAGRRESMVIVAEGATDREGNRITADDVRQVIADKLGEAARVTILGHVQRGGRPSA
YDRWMSTLLGCAAAREVVSMDPGSEPVIIAERHNRIRRLPMMEQIAATRAVKDLVAAHDY
LGAIQARGASFGRMLELFETMSTPPAEPATDTGSTPSASDRPKRVAIIHAGGLAPGMNTA
ARAAVRLGIDHDFTMLGVYGGFPGLLDGDVRELTWADVEGWVGDGGAQLGTRREVPTIEQ
LYALGRAIELHEIDALLVIGGYNAYLSAYRLVTERDRYPAFQIPIVCVPASIDNNLPGSE
LSIGTDTALNNAVVALDSIKLSAAASHRCFVAEVMGRKCGYLSLMSGLATGAEKVYLNEE
GITLAGLAADSERMVESFRSGRSLYLVIRNERASVNYTTDVLAHIFAEEGKGLYDVREAI
LGHQQQGGSPTAFDRIMATKLVAHSLELLACALKRGEPTASYVGLMGGKVSDQPLDRMND
DLDRDHRRPRHQWWLGLRPAVGLVSQDIGTLTLQDVPDFGEAVDDAAS
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
ctgctcggcctggacggcgagcccctgcgcatcggggtcctcacctccggcggcgacgcc
cagggcatgaacgcggccgtgcgggccgtggtgcgcaccgccatccgtctgggggccagg
ccctacgcggtcatggagggctgggccggggccgtggccgggggtgacggcatccgtccc
ctggagtgggactcggtgggctccatcctccagcgcggcggcaccatcatcggcaccgcc
cgctcggccgagttccgcgagcgcgccggccagctggcggccgcccgcaacctgttggag
cacggcatcgaccggctcgtggtcatcggcggcgacggctctctaaccggcaccaacgag
ttccgcaagaactggccctccctgctcgaggagctcgtcgagaccggtgacatcagtgcg
cagacggccgcctcccaccccgtcctcatggtgaccggcctggtgggcagcatcgacaac
gacctggtgggcgccgacatgaccatcggcaccgactccgccctccaccgcatcctggag
gccattgacgacatctcctcgacggccgcctcccaccagcgcaccttcgtcgtggaggtc
atgggtcgccactgcggctaccttgccctcatggcggccgtggccgggggctgtgactac
gtcctggtccccgagctccccccgggcaaggactgggaggaggacatgtgctccaagctc
aaggcgggccgagaggccgggcgccgcgagtccatggtgatcgtcgccgagggcgccacc
gaccgcgagggcaaccgcatcaccgccgacgacgtccgccaggtcatcgccgacaagctg
ggtgaggccgcccgtgtcaccatcctgggtcacgtccagcgcggtggccgccccagcgcc
tacgaccgctggatgtccacgctgctgggctgcgccgccgcccgcgaggtggtgtccatg
gatccgggcagcgagccggtcatcatcgccgagcgccacaaccgcatccgccgcctgccg
atgatggagcagatcgcggccacccgcgccgtcaaggatctcgtggccgcccacgactac
ctcggggcgatccaggcccgcggggcgagcttcggcaggatgctcgagctgttcgagacc
atgtccacgcctcccgccgagccggccactgacacgggatcgacgccgtcggcctccgac
cgccccaaacgggtcgccatcatccacgccggcggcctggccccggggatgaacacggcg
gcgcgtgcggccgtgcgcctgggcatcgaccacgacttcacgatgctgggcgtctacggc
ggcttccccggcctgctggacggcgacgtgcgcgagctgacgtgggccgacgtcgagggc
tgggtcggtgacggtggcgcccagctgggcacgcgccgcgaggtgcccaccattgagcag
ctctacgcgctgggccgggccatcgagctccatgagatcgacgccctgctggtcattggc
ggctacaacgcctacctgagcgcctaccgcctggtcaccgagcgggaccgctaccccgcc
ttccagatcccgatcgtgtgcgtgccggcctccatcgacaacaacctgcccggctccgag
ctgagcatcggcaccgacacggccctcaacaacgcggtggtggcgctggactccatcaag
ctctccgcggcggcctcccaccgctgcttcgtcgccgaggtcatgggccgcaagtgcggc
tacctgtccttgatgtcgggcctggccaccggcgcggagaaggtctacctcaacgaggag
ggcatcacgctggcgggcctggccgccgactccgagcggatggtggagtccttccgctcg
ggacgcagcctctacttggtgatccgcaacgagcgggccagcgtcaactacaccaccgac
gtcctggcccacatcttcgccgaggagggcaagggcctctacgacgtgcgcgaggcgatc
ctgggtcaccagcagcagggaggcagccccacggccttcgaccggatcatggcgaccaag
ctagtcgcccactccctggaactgctggcctgcgccctcaagcgcggtgagccgacggcc
tcctacgtgggcctgatggggggcaaggtctccgaccagcccctggaccgcatgaacgac
gacctcgaccgcgaccaccgtcgcccccgccaccagtggtggctgggtctgcgccccgcc
gtgggcctggtcagccaggacatcgggaccctgacgcttcaggacgtgcccgacttcggt
gaggcggtcgacgacgcggccagctga

DBGET integrated database retrieval system