KEGG   Actinomyces oris: AXE84_11800Help
Entry
AXE84_11800       CDS       T04280                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
aos  Actinomyces oris
Brite
KEGG Orthology (KO) [BR:aos00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aos01001]
    AXE84_11800
Enzymes [BR:aos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AXE84_11800
Protein kinases [BR:aos01001]
 Serine/threonine kinases: Other
  Bacterial family
   AXE84_11800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Kinase-like AAA_28 Pkinase_fungal Kdo
Motif
Other DBs
NCBI-ProteinID: AME00006
UniProt: A0A0X8K3S5
LinkDB All DBs
Position
2922406..2924433
Genome map
AA seq 675 aa AA seqDB search
MVTDPLIGRLVDSRYEIVDRLARGGMATVYRAHDRRLDRTVALKLMHAHLADSPDFVSRF
RREARAAARLSNPGVVAVFDQGSLDGVAYLVMEYVEGPTLRDLIAAGPLSVKEALGLVAQ
LLRPLGAAHRAGLVHRDIKPENVLLPSDGSVAKVADFGLARAVTEVTQTTTGNVLGTVAY
LAPELITSGDSTSRADVFSAGVVLYELLTGQQPFTADSPIQIAFRNVHEDVPLPSKLVPD
MPADVDELVATMTRREPQERPADADEALALLRNVVDELTDSELSVRRGGGTGSIRTQQVM
TANAQAARSAIDNEPQDDADDSSAEESSPHAGMRTVSLPIGSIGPDSKGRTRALSRKALA
ADAQETTAVPTSKKSNGGFSRRRALVIGLLAVAGTGASATWYLTAGPGRRVSVPNIIGMS
EDQAQLALEKQGLDWGTPERVYSDTVPAGSIVSCQPKAGQKVGLGQTVTATVSRGVETKT
VPDVVGKTKDQATAAITAAGLTPGDVTEEYSASVESGKVISCDPKAGKVIKHTEKVSLVV
SKGKEPATIPDVTGMSEDEAKKVLEDAGLKKGKVSKGYSDSVAKGNVISSSPIAGASGYY
KGDSVDLTVSKGPEKVTVPDVTGKSQDEAKKALEDAGLKVEVNKRLGGPFGTVRSTDPAP
GSRVKPDSKVTINIF
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
gtggtcacagatcccctcattggtcggttggtcgactctcgctacgagatcgtcgaccgc
ctagcgcgtggcgggatggccaccgtctaccgcgcccatgaccgtcgcctggaccggacc
gtggcgctcaagctcatgcacgcccacctggccgactcccccgactttgtctcgcgcttc
cgccgtgaggcacgggccgcggcacgcctgtccaacccgggcgtggtggccgtcttcgac
cagggcagcctcgacggggtcgcctacctcgtcatggagtacgtcgaggggcccacactg
cgcgacctcattgcggcaggcccgctgtcggtcaaggaggccctgggcctggtggcccag
ctgctgcgcccgctcggcgcggcccaccgagccggcctggtccaccgcgacatcaagccg
gagaacgtgctgctgccctccgacggctcggtggccaaggtcgccgacttcggcctggcc
cgggcggtcacggaggtgacgcagacgacgacgggcaacgtgctgggcacggtcgcctac
ctggcgccagagctcatcacctccggggactccacctctcgcgccgacgtcttctccgcc
ggggtggtcctctacgagctcctcaccggtcagcagcccttcaccgcggactcccccatt
cagatcgccttccgcaacgtccacgaggacgtgcccctgccctccaagctggtgcccgac
atgccggccgacgtcgacgagctcgtggccaccatgactcgccgtgagccgcaggagcgc
ccggccgacgccgacgaggcgttggcgctgctgcgcaacgtcgtcgacgagctcaccgac
tccgagctctccgtgcgccgcgggggcgggaccggctccatccggacccagcaggtcatg
acggccaatgcgcaggccgcccgctccgccatcgacaacgagccccaggacgacgccgac
gactcctccgccgaggagtcctcgccgcacgctgggatgcgcaccgtctcccttcccatc
ggctccatcggcccggactccaaggggcgaacacgtgcgctctcccgcaaggccctggcg
gccgacgctcaggagaccactgccgtccccacctcgaagaagagcaacggcggcttcagt
cgccgtcgtgcactcgtcatcgggctgctggccgtggctgggaccggtgcgagcgccacc
tggtacctgacggccggtcccggcagacgagtttccgtgcccaacatcattggcatgtct
gaggaccaggcacagctcgccctggagaagcaagggctcgactggggcacgcccgagcgc
gtctactccgacacggtcccggccggcagcatcgtctcctgccagccgaaggcgggccag
aaggtgggactcggccagaccgtcaccgccaccgtctcccgaggcgtggagaccaagacc
gttcccgacgtcgtcgggaagaccaaggaccaggccacggccgcaatcacggcggccggc
ctgaccccgggggacgtcaccgaggagtactccgccagcgtggagtcgggcaaggtcatc
tcctgcgaccccaaggccggaaaggtcatcaagcacactgagaaggtctcgctcgtggtc
tccaagggcaaggagccggctacgatccccgacgtgaccggtatgagcgaggacgaggcc
aagaaggtcctggaggatgccgggctgaagaagggcaaggtcagcaagggctactccgac
tccgtggcgaaggggaatgtcatctcctcctcccccatcgccggggcctcgggctactac
aagggtgactcggtggacctgaccgtctccaaggggccggagaaagtgacggtcccggat
gtgaccggcaagagccaggacgaggccaagaaggccctggaggatgccgggctcaaggtg
gaggtcaacaagcgcctgggcggtcccttcgggacagtgcgctccaccgaccccgcgccg
ggctccagagtcaagcccgactccaaggtcaccatcaacatcttctga

DBGET integrated database retrieval system