KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0004Help
Entry
APP7_0004         CDS       T00717                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase [Cu-Zn] precursor
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Brite
Enzymes [BR:apa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     APP7_0004 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu PepSY_2
Motif
Other DBs
NCBI-ProteinID: ACE60656
UniProt: B3GZJ4
LinkDB All DBs
Structure
PDB: 

Position
complement(4078..4650)
Genome map
AA seq 190 aa AA seqDB search
MKLTNLALAFTLFGASAVAFAHADHDHKKADNSAVEKLVVQVQQLDPVKGNKDVGTVEIT
ESAYGLVFTPHLHGLAQGLHGFHIHQNPSCEPKEKDGKLVAGLGAGGHWDPKETKQHGYP
WSDNAHLGDLPALFVEHDGSATNPVLAPRLKKLDEVKGHSLMIHEGGDNHSDHPAPLGGG
GPRMACGVIK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcacaaatctagctctcgcttttacattattcggcgcatcggcagttgccttt
gcacatgcggatcatgatcataaaaaagcggataacagcgcagtggaaaaacttgtcgta
caagtacaacaacttgatcctgtaaaaggaaacaaggatgtcggtacggtagaaattacc
gaatctgcatacggtttagtgtttactccgcacttacacggtttagctcaaggtttacac
ggcttccatattcaccaaaacccaagctgtgagccgaaagaaaaagacggtaaactggtt
gccggtttaggcgctggcggtcactgggatccgaaagagaccaaacaacacggttatccg
tggtctgataacgcacacttaggcgatttaccggcattattcgtagagcatgacggttct
gcaactaaccctgttcttgcgccacgtttgaaaaaactggatgaagttaaaggtcattct
ttaatgattcacgaaggtggcgataaccactctgatcacccggctccattaggcggtggc
ggtccgcgtatggcttgcggcgtcatcaaataa

DBGET integrated database retrieval system