KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0012Help
Entry
APP7_0012         CDS       T00717                                 

Gene name
ftsI
Definition
(GenBank) peptidoglycan synthetase FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
apa00550  Peptidoglycan biosynthesis
apa01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:apa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    APP7_0012 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    APP7_0012 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:apa01011]
    APP7_0012 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:apa03036]
    APP7_0012 (ftsI)
Enzymes [BR:apa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     APP7_0012 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:apa01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   APP7_0012 (ftsI)
Chromosome and associated proteins [BR:apa03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    APP7_0012 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer NusA_N
Motif
Other DBs
NCBI-ProteinID: ACE60664
UniProt: B3GZK2
LinkDB All DBs
Position
11605..13665
Genome map
AA seq 686 aa AA seqDB search
MAKSVKLKRKPVAIEPNTEVKKQTNTKNEPSYLPIRFGVVGFFILVMAGMLIAKAAHIQL
FDSERLINEANNRSLRTKELPFTRGRILDRNGRFLSISVPMYSLTLDPREYFDSKLRRSP
ERWKLLAMEMGASKSKIEKNVNDFIEKKNTSKEKVAFDPRSILNTKSEDYWTLLAQSTGL
DYNTLIQSVRNNPSSAFLMQEISASQLERSKLEAIAKATGEKYNDLMARLYKASRQRFIY
IARHEPESIANYAQELKIDGMVLKAESRRFYPLAEEASQLIGFTDIDDVHGTEGLERSFD
SLLIGKNGRQVIRKDARGNVIENIRDEKQYDPQDVMLSIDEELQSEVYKKIKEAVIANNA
ESGTAVLVDVQTGEILAMANAPSFNPNKRDSFKPELMRNRAITDTFEPGSTVKPLVVLTA
LQNGATYRDEVINTRPFVVNGHTIKDVAPRESLSLTGILQKSSNIGVSRLALRMPSTALV
DTYSKVGFGKDTGLGLGEQKGTNGDRKRWSDIERATMAYGYGLNITPLQLARAYATLGSF
GIYRPLSITKVDPPVIGERVLPEKITRDVVHMMESVAQKGEGGQKAMVEGYRVAVKTGTA
RKLEKGQYVEKYIAYTAGVVPASDPRFALVVLINEPKAGQYYGGSVSAPLFSSIMGYTLK
TRNIKPDNLTDTESAVREIKLEQKVN
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtcagttaaattaaagcgtaaacccgtggctatcgagccgaatacagaagta
aaaaagcaaactaatactaaaaatgaaccgagttatctcccgattcgttttggtgtggtc
ggttttttcatccttgtaatggcgggaatgctgattgctaaagcggctcatattcagtta
tttgattccgaacgcctgattaatgaagcgaataaccgctcattgcgtactaaagagctg
cctttcacccgaggacgtattcttgatcgtaacggtcgattcttatccattagtgtaccg
atgtactctctcaccctcgatcctcgagaatattttgacagcaaattacgccgaagccct
gaacgttggaaattactggcaatggaaatgggtgcctccaaaagtaaaattgaaaaaaac
gtcaatgatttcatagagaaaaagaatacttcaaaagaaaaagtagcctttgatcctcgt
tctattctcaatacaaaaagtgaagattattggacgcttttagcccaatcgaccgggctg
gattacaatacgttaatccaatcggtgagaaataacccgagttccgcattcttaatgcag
gaaatttccgcctcgcaactcgaacgttctaaacttgaagcgattgccaaagcgaccggc
gaaaaatataacgatttaatggctcgcttatacaaagcttcacgccaacgttttatctac
atcgcacgccacgagccggagagtatcgccaattatgcgcaagaactgaaaatcgacggt
atggtattgaaagccgaatcacgccgtttttatccgctggcggaagaagcttcgcaatta
atcggttttaccgatattgatgacgtacacggtacggaaggtttagagcgtagtttcgat
tctttattaatcggtaaaaacggtcgccaagtgattcgtaaagatgcgcgcggtaatgtg
attgaaaatattcgcgatgaaaaacaatacgatccgcaagacgttatgttgagtatcgat
gaagaattacaatccgaagtatataaaaaaattaaagaagcggttattgccaataatgcc
gaatccggcacggcggtgttggttgatgtgcaaaccggcgaaattttggcgatggcgaat
gcgccttcgtttaacccgaacaaacgggacagttttaagccggaattaatgcgtaaccga
gcgattaccgatactttcgaaccgggttcgacggttaagccgttagtggttttaaccgca
ttgcaaaacggggcgacttatcgcgacgaagtgattaatacgcgtccgtttgtggtaaac
gggcatacgattaaagacgttgcgccgcgtgaaagtttatcgctgaccggtattttacag
aaatcgagtaatatcggggtaagccgtttggcgttacgtatgccgtccaccgcactggtc
gatacttatagcaaggtcggtttcggtaaagataccggtttaggcttgggcgaacaaaaa
gggacgaacggcgatcgtaaacgttggtcggatatcgaacgtgcaaccatggcgtacggt
tacggtttaaatattacaccgttacagcttgcgcgagcttatgcgaccttgggaagtttc
ggtatttatcgaccgctttcgattaccaaagtggatccgccggttatcggcgaacgagta
ttaccggaaaaaattactcgtgacgtagtgcatatgatggaaagtgtggcgcaaaaaggc
gaaggcggtcagaaagcgatggtggaaggttatcgtgtggcggtgaaaaccggtacggct
cgtaaacttgaaaaagggcaatacgtcgaaaaatatattgcctataccgcaggtgttgtg
ccggcaagtgatccccgctttgccttggttgtgttgattaacgaaccgaaagccggacaa
tactacggcggttcggtttccgcgccgttattctcgagtattatgggctataccctgaaa
acgagaaatatcaaaccggataacctcaccgacaccgaaagtgccgtacgagaaattaaa
ttagaacaaaaagtaaattag

DBGET integrated database retrieval system