KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0020Help
Entry
APP7_0020         CDS       T00717                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
apa00473  D-Alanine metabolism
apa00550  Peptidoglycan biosynthesis
apa01100  Metabolic pathways
apa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:apa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    APP7_0020 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    APP7_0020 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    APP7_0020 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:apa01011]
    APP7_0020 (ddlB)
Enzymes [BR:apa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     APP7_0020 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:apa01011]
 Precursor biosynthesis
  Amino acid ligase
   APP7_0020 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 R2K_2 CPSase_L_D2 ATPgrasp_Ter GARS_A ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ACE60672
UniProt: B3GZL0
LinkDB All DBs
Position
23350..24261
Genome map
AA seq 303 aa AA seqDB search
MSIKDEKIAVLFGGVSQEREVSLNSGAAVTEALKSLGYNVEGIDTKDFPIEKLKEKGIQR
VFNILHGGIGENGVLQGALEQMGIPYTGCGVMASAVTLDKFRTKLMWQAVGLPTADMVVV
RRGEAVDSEQIIAKLGLPVFVKPSSEGSSVGVTKVKTVEQLLPAVEEALKFDSIVLVEAF
LAGKEYSVPVLDGQVLPAVQIIPEGEFYDYHAKYISDNTQYLVPALSDDRQAEVAELVKA
AYEVVGCRGWSRIDVMEDANGHFNLVEVNTCPGMTSHSIFPKSAATVGIPFEKLVERVLE
LSA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagcattaaagacgaaaaaattgcggtgttattcggcggtgtttctcaagaacgcgaa
gtatcgctaaattcgggcgcagcggtaaccgaagcgttaaaatcgcttggctataatgtg
gaaggtattgataccaaggatttcccgattgaaaaattaaaagaaaaaggcattcaacgc
gtattcaatattttacacggcggtatcggcgaaaacggtgtgttacaaggcgcactagag
caaatggggattccttataccggttgcggcgtaatggcttcggcagtgacattagataaa
ttccgtaccaaattaatgtggcaagcggttggcctaccaacagcagacatggtggttgtt
cgccgtggagaagcggtcgattccgaacaaattattgcaaaattaggtttaccggttttc
gttaaaccttcaagcgaaggttcaagtgtcggcgtaaccaaagtaaaaacggttgagcaa
ttattgccggcggtggaagaagcgttaaaattcgattcaatcgttttagtagaagctttc
ttggcgggtaaggaatattctgttccggtgctagacggtcaagtattaccggcggtacaa
atcattcccgaaggggagttttatgattaccacgctaaatatatctcggataatactcaa
tatctcgtaccggcgttaagtgacgatcgtcaggcggaagtagcggaactggtcaaagca
gcgtatgaggtggtcggatgccgtggttggagccgtattgatgtgatggaagatgcaaat
ggtcactttaacttagtggaagtgaatacttgtccgggtatgacaagccatagtattttc
cctaaatcggcggcaacggtcggcattccgtttgaaaaattagtcgaacgtgtattggag
ttaagtgcttaa

DBGET integrated database retrieval system