KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0196Help
Entry
APP7_0196         CDS       T00717                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase (SK)
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
apa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
apa01100  Metabolic pathways
apa01110  Biosynthesis of secondary metabolites
apa01130  Biosynthesis of antibiotics
apa01230  Biosynthesis of amino acids
Module
apa_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:apa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    APP7_0196 (aroK)
Enzymes [BR:apa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     APP7_0196 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33 Cytidylate_kin TsaE dNK AAA AAA_17 Thymidylate_kin G-alpha CoaE AAA_5 ABC_tran AAA_16 AAA_29 Mg_chelatase AAA_22 AAA_23 AAA_28 AAA_PrkA AAA_24 IstB_IS21 AAA_7 Rad17 APS_kinase Ploopntkinase3 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: ACE60848
UniProt: B3H036
LinkDB All DBs
Position
complement(221119..221682)
Genome map
AA seq 187 aa AA seqDB search
MNLSHNIEIKEEQTMAEKRNIFLIGPMGAGKSTIGRQLAQMLGMEFIDSDAVIEERAGAD
IDWIFDLEGETGFRKREERIINELTQNQGVVLSTGGGSVLSKENRNVLSARGIVIYLETT
VDKQFERTQRDKKRPLLQTENPRETLEALAKVRNPLYEEIADITLQTDEQSAKLVATHII
ELIDNLQ
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
ttgaatttgtcacataatattgaaataaaagaagaacaaacgatggcagaaaaacgtaat
attttccttataggtcctatgggtgcgggtaaaagcaccattggtcgtcagctcgctcaa
atgctaggaatggaatttattgattctgacgcagtaattgaagaacgtgccggtgcagat
atcgattggatttttgaccttgaaggtgaaaccggttttcgtaagcgtgaagaacgtatt
attaacgagcttacgcaaaaccaaggtgttgtattatcaaccggcggcggttcggtgtta
tccaaagaaaatcgcaacgtcttgtccgctcgcggtatcgttatctaccttgaaactacg
gtggataaacaattcgagagaacgcaacgcgataaaaaacgtccgttgctgcaaacggag
aatcctcgtgaaacgctggaagcactggcaaaagtacgcaatccgctctatgaagaaatt
gcggacattacgctacaaaccgatgagcaaagcgctaaactggttgcgacacacatcatt
gaactgattgataatcttcaataa

DBGET integrated database retrieval system