KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0668Help
Entry
APP7_0668         CDS       T00717                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
apa00240  Pyrimidine metabolism
apa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    APP7_0668 (tdk)
Enzymes [BR:apa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     APP7_0668 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_14
Motif
Other DBs
NCBI-ProteinID: ACE61320
UniProt: B3H151
LinkDB All DBs
Position
complement(743364..743945)
Genome map
AA seq 193 aa AA seqDB search
MAKLYFYYSSMNAGKSTTLLQSSYNYQERGMNTLVYTAAIDDRYGIGKVSSRIGISQEAL
LFQSDTNLFNEIELAHQTETLHCILIDEAQFLTKAQVYQLTDVVDKLKIPVLCYGLRTDF
QAELFEGSQYLLAWADELQELKTICDCGRKAHFVIRMNEKGEAVADGDQIQIGGNDKYLS
VCRYHYKQKLNKL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttttattactcctcaatgaatgcgggcaaatcaaccaccctgctt
caatcctcttataattaccaagaacgaggtatgaatacgttggtttataccgcagcgatt
gatgatcgttacggcatcggtaaagttagttctcgtatcggaatttcacaagaagcatta
ttgtttcagtcggacactaatttatttaacgaaatcgaactggctcatcaaacagaaacg
ttacactgtatcttaattgacgaagcccaatttctgaccaaagcgcaggtctatcaatta
accgacgtggtggataaacttaagattccggtgctttgttatggtttacgtaccgatttc
caagccgaactttttgaaggcagtcaatacctattggcatgggcggacgaactgcaagaa
cttaaaacgatttgcgattgcggtcgaaaagcgcattttgtgattcgtatgaacgaaaaa
ggtgaagcggtcgccgacggagaccaaattcaaatcggcggaaatgataaatatctttcc
gtatgtcgttatcattacaaacaaaaactcaataaactctaa

DBGET integrated database retrieval system