KEGG   Alcanivorax pacificus: S7S_00725Help
Entry
S7S_00725         CDS       T03580                                 

Definition
(GenBank) glutathione S-transferase domain-containing protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
apac  Alcanivorax pacificus
Pathway
apac00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:apac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    S7S_00725
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:apac02000]
    S7S_00725
Enzymes [BR:apac01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     S7S_00725
Transporters [BR:apac02000]
 Other Transporters
  Pores ion channels [TC:1]
   S7S_00725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4 Tom37 DSX_dimer
Motif
Other DBs
NCBI-ProteinID: AJD46569
UniProt: A0A0B4XEX7
LinkDB All DBs
Position
complement(153381..154049)
Genome map
AA seq 222 aa AA seqDB search
MITVHHLENSRSQRVLWLLEELGLPYEVKRYARDPKTMLAPAELKAVHPLGKSPVITDEG
RTIAESGAIIEYLVAKTGGQLAPAPDSPAGLDYRYFMHYAEGSLMPLMVMSLVFTRIPKS
PMPFFARPIARALCGKVRSSFLQPQIIDHLAMLEAHLGKQTWFAGDDFSAADIQMSFPLE
AAATRAGGDRYPALTAFLSRIHDRPAYQRALERGGPYRILGG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgttcatcacctggaaaattcacgctcacaacgtgtcctgtggctgcttgaa
gagctcgggctgccctatgaggtgaaacgctacgcccgcgacccgaaaaccatgctcgcg
ccagccgagctcaaggccgtgcaccccctgggcaaatcgccggtgatcacggacgaaggc
cgcacgatcgccgaatccggcgccatcatcgaatatctggtggcgaagaccggcggccag
ctcgcccccgccccggacagccccgccgggctggattaccgctacttcatgcactacgcc
gaaggctcgctgatgccgctgatggtgatgtcgctggtgttcacccgcatcccgaaatcg
cccatgccgttcttcgcccggcccatcgcccgcgccctgtgcggcaaggtgcgcagcagc
ttcctgcaaccacagatcattgatcacctggccatgctggaggcacacctgggcaagcag
acctggttcgccggcgacgatttcagcgccgccgatatccagatgagcttcccgctggaa
gccgccgccacccgcgccggcggcgaccgctacccggccctgacggcgttcctgtcccgc
atccacgaccggcctgcctaccagcgcgcactggaacggggtggcccgtaccggattctc
ggtggctga

DBGET integrated database retrieval system