KEGG   Alcanivorax pacificus: S7S_01620Help
Entry
S7S_01620         CDS       T03580                                 

Gene name
hisE
Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
apac  Alcanivorax pacificus
Pathway
apac00340  Histidine metabolism
apac01100  Metabolic pathways
apac01110  Biosynthesis of secondary metabolites
apac01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    S7S_01620 (hisE)
Enzymes [BR:apac01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     S7S_01620 (hisE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH
Motif
Other DBs
NCBI-ProteinID: AJD46748
UniProt: A0A0B4XJK2
LinkDB All DBs
Position
complement(332981..333319)
Genome map
AA seq 112 aa AA seqDB search
MSEILTRLHDVLEARKGMAPESSYVASLYHKGLNKILEKVGEEAVETILAARDVDAGGDP
QSLISETADLWFHTLVMLAKLNTGPEPVLAELERRFGLSGLDEKASRPQSNT
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagatattgacccggttgcatgacgtgctggaagcccgcaagggcatggcgccg
gagtcgtcctatgtcgccagcctctaccacaagggcctgaacaagattctggaaaaagtc
ggcgaggaagccgtcgaaaccatcctcgccgcccgggatgtcgacgccggcggtgacccg
cagtcgctgatttccgaaaccgccgacctctggtttcatacgttggtcatgctggccaag
ctcaataccgggccggagccggtgctggcggaactggaacgtcgtttcggcctgtccggc
ctggacgaaaaagcctcacggccacagagcaatacctga

DBGET integrated database retrieval system