KEGG   Alcanivorax pacificus: S7S_11760Help
Entry
S7S_11760         CDS       T03580                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
apac  Alcanivorax pacificus
Brite
KEGG Orthology (KO) [BR:apac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    S7S_11760
Enzymes [BR:apac01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     S7S_11760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 DAO FAD_oxidored Glutaredoxin FAD_binding_3 Thi4 K_oxygenase AlaDh_PNT_C FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AJD48764
UniProt: A0A0B4XKF7
LinkDB All DBs
Position
2672573..2674141
Genome map
AA seq 522 aa AA seqDB search
MLDANLKTQLQTYMERISEPFEIVASLDDGDKSRELAELLRDIEGMSDKISLREDGDDAR
KPSFSLNRVGGDISLRFAGIPMGHEFTSLVLALLQVGGHPPKVSDEVIAQVKALQGDFQF
ETYFSLSCQNCPDVVQALNLMAVLNPNIKHVAIDGALFQAEVDERQVMAVPSVFLNGEAF
GQGRMGLEEILAKLDTGAAERDAEKLSAKEAFDVLVVGGGPAGAASAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVTETEGPKLATALEQHVREYDVDIMNLQRAEQLIPGTDGGL
HEVKFASGASLKAKTLILATGARWREVNVPGEKEYRGRGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVEHVTLLEFDSKLRADAVLQKKLHSLKNVTVIVSAQTSEITGDGT
RVNGLVYKDRNSNEEYRVDLAGVFVQIGLVPNTDWLKGTVELSRFGEIITDARGETSVPG
IFAAGDVTTVPYKQIVIAVGEGAKASLSAFDYLIRHSVDVAA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaacctcaagacccaactgcagacgtacatggaacgcatcagcgagccg
ttcgagattgtcgcgtcccttgatgatggcgacaaatccagagaactggccgaactgctg
cgcgatatcgaaggcatgtccgacaagatcagcctgcgcgaagacggcgacgacgcccgt
aaaccgtcgttcagcctgaaccgtgtcggcggtgacatcagcctgcgcttcgccggcatc
cccatgggccacgagttcacctcgctggtgctggccctgctgcaggtgggcggccacccg
ccgaaagtcagcgacgaggtgatcgcacaagtgaaggcgctgcaaggcgacttccagttc
gaaacctacttctcactgtcctgccagaactgcccggacgtggtccaggcattgaacctg
atggcagtgctgaacccgaacatcaaacacgtcgccattgacggcgccctgttccaggcc
gaagtcgacgagcgccaggtgatggccgtgccgagcgtgttcctcaacggcgaagccttc
ggccagggccgcatgggcctggaagaaatcctcgccaagctcgataccggcgccgccgaa
cgcgatgcggaaaaactgtccgccaaggaagccttcgatgtgctggtcgtgggcggtggc
cctgcgggggctgccagtgccatctacgcggcccgcaaaggcatccgcaccggcgttgcc
gctgaacgctttggcggccaggtgctggacaccatggcgatcgaaaatttcatctcggtc
accgagaccgaaggcccgaaactggccaccgcgctggaacaacacgtgcgtgagtacgac
gtggacatcatgaacctgcaacgggccgagcaactgatccccggcaccgacggcggcctg
cacgaagtgaaattcgcctccggcgccagcctgaaagcgaagaccctgatcctggccacc
ggcgcccgctggcgcgaagtgaacgtgccgggtgagaaggaataccgtggccgtggcgtg
gcctactgcccgcactgcgacggcccgctgttcaaaggcaagcgcgtggcagtaatcggc
ggcggcaactccggcgtggaagcggccatcgacctggccggtatcgtcgagcatgtgaca
ctgctggaattcgacagcaagctgcgcgctgatgccgtgttgcagaaaaaactgcacagc
ctgaagaacgtaaccgtgatcgtcagcgcccagaccagcgagatcaccggcgacggcacc
cgcgtcaacgggctggtgtacaaggaccgcaacagcaatgaagagtaccgcgtggacctg
gccggcgtgttcgtgcagatcggcctggtgccgaacaccgactggctgaaaggcactgtg
gagctgtcacgcttcggcgagatcatcaccgatgcgcgcggcgaaacctccgtccccggc
atctttgccgccggcgacgtgaccaccgtgccctacaagcagatcgtgattgccgtcggc
gaaggcgccaaggcatcactcagcgcctttgattacctgatccgccattcggttgacgtc
gcggcctga

DBGET integrated database retrieval system