KEGG   Alcanivorax pacificus: S7S_14160Help
Entry
S7S_14160         CDS       T03580                                 

Definition
(GenBank) anthranilate synthase, component II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
apac  Alcanivorax pacificus
Pathway
apac00400  Phenylalanine, tyrosine and tryptophan biosynthesis
apac01100  Metabolic pathways
apac01110  Biosynthesis of secondary metabolites
apac01130  Biosynthesis of antibiotics
apac01230  Biosynthesis of amino acids
apac02024  Quorum sensing
Module
apac_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:apac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    S7S_14160
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    S7S_14160
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    S7S_14160
Enzymes [BR:apac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     S7S_14160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: AJD49244
UniProt: A0A0B4XLU4
LinkDB All DBs
Position
complement(3198977..3199561)
Genome map
AA seq 194 aa AA seqDB search
MAKLLMIDNYDSFTYNIVQYLQELGAEVLVHRNDAITLAQIEALAPDRLMISPGPCTPNE
AGISMEAIAHFAGKLPILGVCLGHQSIGQVFGGKVVRARQVMHGKTSPIYHRGVGVFRGL
PSPYTATRYHSLVVEKDSLPECLEMTAWTQHADGSVDEIMGMRHRTLDIEGVQYHPESIL
TEHGHALLKNFLER
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctaaactgttgatgatcgacaattacgacagcttcacctacaacatcgtgcagtac
ctgcaggagctgggcgccgaggtgctggtgcatcgcaacgacgctatcacgctggcgcag
atcgaggcgctggcgccggaccggctgatgatttcccccggcccctgcacgcccaatgaa
gccggtatttcgatggaagccatcgctcactttgccggcaagctgccgatcctgggtgtc
tgtctggggcaccagagcatcggccaggtgttcggcggcaaagtggtgcgggcgcgtcag
gtgatgcatggcaagacttcgccgatttaccaccggggtgtcggggtgttccgtggcctg
ccttcgccgtacaccgccacgcgttaccattcactggtggtggaaaaagacagcctgccg
gagtgcctggaaatgaccgcctggacgcagcacgcggacggcagcgtggacgagatcatg
ggcatgcggcaccgcacgctggacatcgagggggtgcagtatcacccggaatccattctc
acggagcatggccatgctctgctgaaaaacttcctggagcgttga

DBGET integrated database retrieval system